KEGG   Burkholderia lata: Bcep18194_C6916Help
Entry
Bcep18194_C6916   CDS       T00286                                 

Definition
(GenBank) NUDIX hydrolase
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ABB05962
UniProt: Q39NK4
Position
3:470543..471250
Genome map
AA seq 235 aa AA seqDB search
MEPDRSIPNTGGGLAGVHAEAGSPQALLDAIVRGVEGRGIPAGTDWPTAKQSLADNEGQW
KFSAVLVAIVARREPTILLTKRSPDLSEYSSHVSFPGGRPAESDRDIGATALREAFEEIR
LAPDAVRVAGSLPIHQTRKRNHAIFPVIGIVPETAKWEAAPAEVAEIFEFPFAALLNPDL
PRQYTDGERTGAWYWAEQTQDIWGVTALILKSLAGLVRDAVRGDAFMHRAFVRQG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagacagaagcatcccgaataccggcggcgggttggccggcgtgcatgcggaa
gccggctcgccgcaggcgctcctggacgcgatcgtccgtggcgtggaaggccgcggcatc
cctgccggcactgattggccgacggcgaagcaaagcctcgcggacaacgaggggcagtgg
aaattctcggcggtgctggtcgcgatcgtcgcgcggcgcgagccgacgatcctgctgacc
aagcgttcgccggatctcagcgaatactcgtcgcatgtgagttttccgggcggacgcccg
gccgagtccgaccgcgatatcggcgcgactgcgttgcgcgaggcgttcgaggaaatccgc
ctcgcgcccgatgcggttcgcgtggctggcagcttgccgattcatcaaaccagaaagcgc
aatcacgcgatctttcccgtgatcggcatcgtgccggaaacggcgaaatgggaagcggcg
cccgcggaagtcgcggagatcttcgagtttccgttcgccgcgctgctgaatccggatctg
ccgcgccaatacacggacggcgagcgcacgggcgcgtggtactgggcggagcagacgcag
gacatctggggcgtgacggcgctcatcctgaagtcgctcgcggggctggtacgcgatgcc
gtgcgcggcgatgcgttcatgcaccgggccttcgtccggcaagggtga

DBGET integrated database retrieval system