KEGG   Burkholderia lata: Bcep18194_C6917Help
Entry
Bcep18194_C6917   CDS       T00286                                 

Definition
(GenBank) Drug resistance transporter, EmrB/QacA subfamily
  KO
K08169  MFS transporter, DHA2 family, multidrug resistance protein
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bur02000]
    Bcep18194_C6917
Transporters [BR:bur02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    Bcep18194_C6917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: ABB05963
UniProt: Q39NK3
Position
3:471254..472645
Genome map
AA seq 463 aa AA seqDB search
MEMAETFGDEGFDIPRRYFAAVAILVGVFMSALDSAIVNIALPTISADLHVSAASVIWVA
NGYQVASAATMLTCASLGSRIGERRFYTIGLVLFTIASLGCGLASTFGALVVMRILQGIS
YAILISVGYGLYRVIFPPASLGTIFGVNALIFAVGTAVGPALGGLIVSWASWPWLFFINL
PFGIAAIAFSFVALGKDTHRERGFDVPGAVTSAAAFGLFALAVDQIGRWSNRTVLVLAVA
AAALMLAFCIGQTRARHPLLPLDIFRSRRYTFAVLTSVTMFVSQGMALVALPFVLQHTYA
YSVLKSALVFTPWPIAVALCAPFAGRLANRFNATQLSSVGVLTFCLGIGSLILLPAQPTV
GDFLWRVALCGVGYGFFLPPNNKEMFANAAKNRTATASGVLSTARTTGQSIGAALVAVVI
ALVGGAGGGGGERLFPVYVFALACAIAALSFFASIARIYRQRG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagatggcagaaacgttcggcgacgaagggttcgacatcccgcgccgctattttgca
gcggtcgcgattctggtcggcgtattcatgtccgcactggacagtgcgatcgtcaatatc
gcgctgccgacgatctcggccgacctgcacgtgagcgcggcgtcggtcatctgggtcgcg
aacgggtatcaggtggcgagcgcggcgacgatgctgacgtgcgcgtcgctcggctcgaga
atcggcgagcgacgcttttacacgatcgggctcgtgttgtttacgatcgcgtcgctcggc
tgcggcctggcgtccaccttcggcgcgctggtggtgatgcggatcctgcaggggatcagc
tacgcgatcctgatcagcgtgggctacggtctctaccgggtgatctttccgcccgcttcg
ctggggacgatcttcggcgtcaatgcgctgatattcgcggtggggacggccgtcggcccc
gcattgggcggcctgatcgtctcgtgggcatcgtggccctggctgttcttcatcaacctc
ccgttcgggatcgctgcgatcgcgttctcgttcgtcgcgctggggaaggacacgcatcgg
gagcgcggcttcgacgtgccgggcgcggtgacttccgccgcggcattcggcctcttcgcg
cttgcggtcgaccagatcggacggtggagcaaccgtaccgtgctcgtgcttgccgtcgcg
gcggcggcgttgatgctggccttctgcatcgggcagacccgggcacgccatccgctgttg
ccactggatattttcaggtcgcgccggtacacgttcgcggtgctgacgtccgtgacgatg
ttcgtgtcgcagggcatggccttggtggcgttgccgttcgtgctgcagcacacgtatgcg
tacagcgtgttgaaatcggcgctggtctttacgccctggccgatcgcggtcgcgctgtgc
gcgccatttgccgggcgactggcgaatcgcttcaatgcgacgcagctgtcgagcgtcggc
gtgctgacgttttgtctcgggatcgggtcgctgatcctgttgcccgcgcaaccaacggtc
ggggatttcctgtggcgcgttgcgctgtgcggcgtggggtacggcttcttcctgccgccg
aacaacaaggagatgtttgcgaacgcggcgaaaaaccggacggccaccgcgtcaggcgtg
ctgtcgaccgcgagaacgaccggccagtcgatcggcgccgcgctggttgccgtggtgatc
gcactggtgggcggcgcgggcggaggagggggcgagcggctgtttcccgtctacgttttc
gcgttggcttgcgcgatcgccgcgctgtcgttctttgcaagcatcgcgcgcatctaccgg
cagcggggctag

DBGET integrated database retrieval system