KEGG   Burkholderia lata: Bcep18194_C6919Help
Entry
Bcep18194_C6919   CDS       T00286                                 

Definition
(GenBank) Short-chain dehydrogenase/reductase SDR
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase
Motif
Other DBs
NCBI-ProteinID: ABB05965
UniProt: Q39NK1
Position
3:473758..474588
Genome map
AA seq 276 aa AA seqDB search
MASSKLMLITGVSSGFGRALAQEALAAGHTVVGTVRSAQAARDFDVLSAQAFARVLDVTD
FDRIDGVVADIEANVGPVDVLVNNAGYGHEGIMEEAPLAEMRRQFDVNVFGAVAMMKAVV
PFMRERRRGHILNITSMGGHITMPGITYYCGSKFALEGISESLGKELEPFGIAVTAVAPG
SFRTEWAGRSMLRTPRSIADYDAIFDPIRQAREEKSGKQLGDPAKAARAMLAVIAADHPP
AHLLLGSDALRLVRGKLAALDEEIRAWEAVTVSTDG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagcaagctcatgctcatcaccggcgtcagcagcggctttggccgcgcgctc
gcgcaggaggcgctcgcggcgggtcacacggtggtcggcaccgtgcgaagcgcgcaggcg
gcgcgggatttcgacgtgctgtccgcgcaggcgttcgcgcgggtactcgacgtgaccgac
ttcgatcgcatcgacggcgtcgtggcggacatcgaggcgaacgtcgggcccgtcgacgta
ctggtgaacaacgcaggctacgggcacgaagggatcatggaagaagcgccgctcgcggaa
atgcgccggcagttcgacgtgaacgtattcggcgcggtcgcgatgatgaaggcggtcgta
ccgttcatgcgggaacggcggcgcggccacatcctcaacatcacgtcgatgggcggtcac
atcacgatgccgggcatcacttactactgcggcagcaagtttgcgctggaaggcatttcc
gaatcgcttggcaaggagcttgagccgttcggcatcgcggtgacggctgtggcgccgggt
tcgttccgcaccgagtgggccggccgctcgatgctgcgcacgccgcgctcgatcgcggat
tacgacgcgattttcgacccgatccgccaggcacgcgaagagaagagcggcaagcagttg
ggcgatcccgcgaaggctgcgcgggcgatgctcgcggtgatcgcggcggaccatccgcct
gcgcatctgttgctcggcagcgatgcgctgcggctggtgcgcgggaagctggcggcactg
gacgaggaaattcgcgcgtgggaggccgtgacggtgtcgacggatggttga

DBGET integrated database retrieval system