KEGG   Burkholderia lata: Bcep18194_C6920Help
Entry
Bcep18194_C6920   CDS       T00286                                 

Definition
(GenBank) Alpha/beta hydrolase
  KO
K00433  non-heme chloroperoxidase [EC:1.11.1.10]
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcep18194_C6920
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.10  chloride peroxidase
     Bcep18194_C6920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Peptidase_S9 Peptidase_S15 DLH Abhydrolase_2 Abhydrolase_4 AXE1 DUF1749 EHN
Motif
Other DBs
NCBI-ProteinID: ABB05966
UniProt: Q39NK0
Position
3:474748..475584
Genome map
AA seq 278 aa AA seqDB search
MPTVTTKDHVEIFYKDWGPKDAQPIMFHHGWPLSGDDWDAQMLFFVQKGYRVVAHDRRGH
GRSAQVSDGHDMDHYAADAFAVVEALDLRNAVHIGHSTGGGEVARYVAKHGEPAGRVAKA
VLVSAVPPLMLKTASNPEGLPLEVFDGFRKALADNRAQFFLDVPSGPFYGFNREGATVHQ
GVIRNWWRQGMEGSAKAHYEGIKAFSETDQTEDLKSISVPTLVLHGEDDQIVPIADAALK
SIKLLKNGTLKTYPGYSHGMLTVNADVLNADLLAFVQA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccgtcacaacgaaggatcacgtcgagattttctacaaggactggggcccgaag
gacgcgcagcccatcatgttccaccacggctggccgttgtccggcgacgactgggacgcg
cagatgctcttcttcgtccagaagggctatcgcgtggtggcgcacgatcgtcgtggccac
ggccggtcggcgcaggtgtcggacggccatgacatggatcactacgcggcagacgcgttc
gcggtcgtcgaagcgctcgacctgcgcaatgcggtgcacatcggtcactcgaccggtggc
ggcgaagtggcgcgctatgtcgcgaagcacggcgagccggccggccgcgtcgcgaaggcg
gtgctggtcagcgcggtgccgccgctgatgctgaaaaccgcatcgaaccccgaaggcctg
ccgctcgaggtgttcgacggtttccggaaagcgctcgccgacaatcgcgcgcagttcttc
ctcgatgtgccgagcggcccgttctacgggttcaaccgcgaaggtgcaaccgtccatcag
ggcgtgatccgcaactggtggcggcaggggatggaaggtagcgccaaagcgcattacgaa
ggcatcaaggcgttttcggaaacggaccagaccgaagacctgaagtcgatctccgtcccg
acgctcgtgctgcacggcgaagacgaccagatcgtgccgatcgcggatgccgcgctgaag
tcgatcaagctgctgaagaacggcacgctgaagacctacccgggctactcgcacgggatg
ctgacggtcaacgcggacgtgctcaacgccgacctgctggctttcgtgcaggcgtaa

DBGET integrated database retrieval system