KEGG   Burkholderia lata: Bcep18194_C6925Help
Entry
Bcep18194_C6925   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABB05971
UniProt: Q39NJ5
Position
3:complement(478633..480804)
Genome map
AA seq 723 aa AA seqDB search
MPNSPLLHRNLFAALAASLLWIPAAHASGDDGCYAPTTLRQTNYSCANVPMLSPANDTRI
NAMLMMVDSAKVAQAFPDPKTIPAKDRINQIIVPFPMDFSGWISIGQKEPDKTDGAADTG
TPSNQYADGEGSICRSMTSGADAFSDALGGAGGLPADEATRLRAARADIAQKTCAAGGAS
AAWTKPPVKSPLGQQFAAYLDGTNAFYRADFLTATKAFANASHSANPWLKETGLYMAGRA
QLNAAQANVFDNDSPTPTRGRVTKVSLDAANTVFRTYLKVYPQGRYATSATGLLRRVAWL
GGNVTQQADLYGHALARWSPATSNVPLIQLANELDSKLLFGSDYDASQIQSPTVLATVDL
LRMRTSENSDSSRAKPLTLDELQAQKPRFANAPALYDYLLATWYVQIGHKPDAALALLPQ
TPAEPLDYFGLSQQALRGFALEDSGQSDKARQLWRDLIPLAKFRFQREALELALAINLEQ
AGLVNDAFADDSPVQNAAIRAVLLQRSANADLLRAQAQNQATGGAMRDTALYTLLYKELT
RSHYAEYIADAVLVSGKPADPLKPFIAAGAKNEDGYACPSANDIAAALQQNPADAKGLNC
LADFVRLHPPAPGLENDPVPMWIRNASTTAATRIPPTLGAGPSQFAGKPYERMSSYVTVM
ADAQANPNDRAYAYYRAIKCYAPGGSNECGGKDVPKNVRKRWFDTLKASYAGSPWAQKLR
YYW
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatagcccattgctgcaccgaaacctgttcgccgcgctggcggccagcctgctc
tggattccggctgcccatgccagcggggacgacggctgctatgcgccgaccacgctccgg
cagaccaactactcctgcgccaacgtgccgatgctgagccccgccaacgacacgcgcatc
aacgcgatgctgatgatggtcgacagcgccaaggtcgcgcaggcatttccggacccgaag
acgatcccggcgaaagaccggatcaaccagatcatcgtgccgtttccgatggacttttcc
gggtggatctcgatcgggcagaaggagcccgacaagaccgacggcgcagcggataccgga
acaccgtcgaaccagtatgccgacggcgaaggcagcatctgccgcagcatgacctcgggc
gccgatgcgttcagcgacgcactgggcggtgccggcggcctccccgccgatgaagccacg
cgcctgcgcgcggcacgcgccgacatcgcgcagaagacctgcgccgcgggcggcgcgagc
gcggcctggacgaaaccgccggtcaagtcgccgctcggccagcagttcgccgcgtacctc
gacggcacgaacgcgttctatcgcgccgacttcctcaccgcgaccaaggcctttgcgaac
gcatcgcacagcgcgaacccgtggctgaaggaaaccgggctctatatggccgggcgcgcg
cagctgaacgccgcgcaggccaacgtgttcgacaacgacagccccacgccgacgcgcggc
cgcgtgacgaaggtgtcgctcgacgccgcgaatacggtgtttcgcacttacctgaaggtg
tatccgcaggggcgctatgcgacctccgcgacggggctgttgcggcgtgtcgcgtggctc
ggcggcaacgtcacgcagcaggccgacctgtacggccacgcgctcgcgcgctggtcgccg
gcaacgtcgaatgtgccgctgatccagctggcgaacgaactcgacagcaagctgctgttc
gggtcggactacgacgcgagccagatccagtcgccgaccgtgctcgcgaccgtcgacctg
ctgcgcatgcgcacgtcggaaaacagcgactcgagccgcgccaagccgctgacgctggac
gaactgcaggcgcagaagccgcgcttcgcgaatgcgcccgcgctctacgactacctgctc
gcgacctggtatgtccagatcgggcacaagccggacgccgcgctcgcgttgctgccgcag
acgcccgcggaaccgctcgactacttcggcctgagccagcaggcgctgcgcggattcgcg
ctggaggatagcggccagtccgacaaggcgcgccagctgtggcgcgacctgatcccgctc
gcgaaattccgcttccagcgcgaagcgctggaactcgcgctcgcgatcaacctggaacag
gccgggctcgtcaacgacgcgttcgccgacgattcgccggtacagaacgccgcgatccgc
gccgtgctgctgcaacgctcggccaatgcggacctgctgcgtgcgcaggcgcaaaaccag
gcgaccggcggcgcgatgcgcgacaccgcgctgtacacgctgctgtacaaggaactcacg
cgctcgcattacgccgagtacatcgcggatgccgtgctggtgtccggcaagcctgccgat
ccgttgaagccgttcatcgcagccggcgccaaaaacgaagacggttatgcgtgcccgtcg
gcgaacgacatcgccgcggcactccagcagaatcccgccgatgcgaaagggctgaactgt
ctcgccgatttcgtgcgcctgcacccgcccgcgcccggcctcgaaaacgatccggtgccg
atgtggatacgcaacgcatcgacgacggccgccacccgcatcccgccgacgctcggcgcc
gggccgtcgcagttcgccggcaagccgtacgagcggatgtcgagctacgtgacggtgatg
gccgatgcgcaggcgaacccgaacgaccgcgcctacgcgtactaccgtgcgatcaagtgc
tatgcgccgggcggctccaacgaatgcggcggcaaggacgtgccgaagaacgtgcgcaag
cgctggttcgatacgctgaaggccagctacgcggggagcccgtgggcgcagaagctccgc
tactactggtaa

DBGET integrated database retrieval system