KEGG   Burkholderia lata: Bcep18194_C6927Help
Entry
Bcep18194_C6927   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5058
Motif
Other DBs
NCBI-ProteinID: ABB05973
UniProt: Q39NJ3
Position
3:482801..483133
Genome map
AA seq 110 aa AA seqDB search
MKKILQRTVTLRTVLGAAVAGLVLSACGSTQMNMIDVQTSTAKTLGLASSDEITVANVQY
GKKDGLGGQKVSYDATTGKGRRFGCTVFMIPGLTPIDRPTYNNWECHPQR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcttgcagcgcaccgtgaccttgaggactgtgctgggtgcggcggtcgcc
ggcctcgtgttgtcggcgtgcggttcgacgcagatgaacatgatcgacgtgcagacgtcg
accgcgaagacgctcgggctcgcgtcgtcggacgagatcacggtcgccaacgtgcagtac
ggaaagaaggacgggctgggcggccagaaggtgagttatgacgcgacgaccggcaagggg
cggcgtttcggctgtacggtgttcatgattccggggctcacgccgatcgatcggccgacg
tacaacaactgggaatgccatccgcaacgctga

DBGET integrated database retrieval system