KEGG   Burkholderia lata: Bcep18194_C6939Help
Entry
Bcep18194_C6939   CDS       T00286                                 

Definition
(GenBank) gluconolactonase
  KO
K14274  xylonolactonase [EC:3.1.1.-]
Organism
bur  Burkholderia lata
Pathway
bur00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcep18194_C6939
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     Bcep18194_C6939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Arylesterase FIST
Motif
Other DBs
NCBI-ProteinID: ABB05985
UniProt: Q39NI1
Position
3:495130..496056
Genome map
AA seq 308 aa AA seqDB search
MHKNRISMTTVKLVQGANAILGEGPLWCERSASLYWIDIKRTALYRYTPGHGQTGFWLLP
ELAGCVASVDDGRLLVALKSGLHLFDPAHGTLERLADAAHARPSLRYNDGAVDARGRFWV
GTMADDGDGPGDLHCFEHAHASRVAVAGFACANGMGWSPDGSTMYVTDSGRRTIFAYDFD
VDAGRLSNARPFATFGDARGVPDGLAVDAEGGVWSAIWDGWRLHRYAPDGALDQVVEMPV
QRPTSVAFGGADRATLFVTSASVNVSADGLLRGPLAGSLFETRPGVAGLEQHCVARAWLG
DAVAATPR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaaacagaatttcgatgacgacagtaaaactggtacagggcgcgaatgcgatc
ctgggagagggcccgctctggtgcgaacgctcggcgtcgctctactggatcgacatcaag
cgcaccgcgctctaccgctacacgcccggccacgggcagaccggcttctggctgctgcct
gagctggccggctgcgtcgcgagcgtcgacgacgggcggctgctcgtcgcgttgaagagc
ggcctgcacctgttcgatcccgcgcacggcacgctcgaacggctggccgacgccgcgcat
gcgcggccgtcgctgcgctacaacgacggcgcggtggatgcgcgcggccgcttctgggtc
ggcacgatggccgacgacggcgacggccccggcgatctccattgcttcgagcatgcgcat
gcgtcgcgcgtcgcggtggccggcttcgcctgcgcgaacgggatgggctggagcccggac
ggctcgacgatgtacgtcaccgattccggccgccgcacgatcttcgcgtacgacttcgac
gtcgatgcagggcggttatcgaatgcgcggccgttcgcgacgttcggcgacgcgcgcggc
gtgccggacgggcttgccgtcgatgcggagggcggcgtgtggtcggcgatctgggatggc
tggcggctgcatcgctacgcgccggacggcgcgctcgaccaggtcgtcgagatgccggtg
cagcggccgaccagcgtcgcgttcggcggcgccgatcgcgcgacgctgttcgtcacgtcc
gcatcggtcaacgtgagtgcggacgggctgctgcgcggcccgctcgcgggcagcctgttc
gagacgcgcccgggcgtggccgggctcgagcagcattgcgtggcgcgcgcgtggctgggt
gacgcggtcgcggccacgccgcgttga

DBGET integrated database retrieval system