KEGG   Burkholderia lata: Bcep18194_C6942Help
Entry
Bcep18194_C6942   CDS       T00286                                 

Definition
(GenBank) 2-keto-3-deoxygalactonate kinase
  KO
K00883  2-dehydro-3-deoxygalactonokinase [EC:2.7.1.58]
Organism
bur  Burkholderia lata
Pathway
bur00052  Galactose metabolism
bur01100  Metabolic pathways
Module
bur_M00552  D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Bcep18194_C6942
Enzymes [BR:bur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.58  2-dehydro-3-deoxygalactonokinase
     Bcep18194_C6942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DGOK
Motif
Other DBs
NCBI-ProteinID: ABB05988
UniProt: Q39NH8
Position
3:498565..499707
Genome map
AA seq 380 aa AA seqDB search
MQDATPRPGGQAPVPRLIALDWGTTSLRAYLMADARTVLDERAAPKGVMQLGGTGIAIAD
ACDAAFEDVCGGWLDAWPALPVVAAGMVGSTQGWREAPYAGVPIDATRLGASLQTVRARR
GVTVHIVPGLIQRGELANVMRGEETQIVGALQAGGATHGATNGTAPVRWIGLPGTHSKWV
AVRGSRIERFCTFMTGELYALLCTHSLLGRTMQPSAGFLRDAFERGVRAAQAGHATGLLA
TIFGSRARLLAGDLAPAEQADYLSGVLIGHELAGLAAEPCGPGGAARDAALRPMLIGDAV
LCERYKHAASLFGWPPVDTIDGAAAAGLWVLAERAGLLPAASEEGAPVRVDEPAAGMSGR
HEDRPAVDSIPDHECHISGD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgcaacaccacggcccggcggccaagcgccggtgccacgcctgatcgcactc
gactggggcaccacgtcgctgcgcgcatacctgatggcggatgcgcggacggtgctcgac
gagcgggccgcaccgaagggcgtgatgcagctgggcggcacgggcatcgcgatcgccgac
gcatgcgatgcggcgttcgaggacgtgtgcggcggatggctcgacgcatggccggcgctg
ccggtcgtcgcggccggcatggtcggcagcacgcaaggctggcgcgaggcgccgtatgcg
ggcgtgccgatcgatgcaacgcggctcggcgcgtcgctgcagacggtgcgcgcgcggcgc
ggcgtgaccgtgcacatcgtgccggggctgatccagcgcggtgagctggcgaacgtgatg
cgcggcgaggagacgcagatcgtcggcgcgctgcaggcgggcggtgcgacgcatggcgcg
acgaacggcacggcgccggtccggtggatcgggttgccggggacgcattcgaagtgggtt
gccgtgcgcggctcgcgcatcgaacgcttctgcacgttcatgacgggcgaactgtacgcg
ctgctgtgcacgcacagcctgctcggccgcacgatgcagccgtcggccgggttcttgcgc
gacgcgttcgagcgcggcgtgcgcgccgcgcaggccggccatgcgacggggctgctcgcg
acgatcttcggcagccgtgcgcggctgctggccggcgatctggcgcccgccgagcaggcc
gactacctgtccggcgtgctgatcggccatgagctcgcggggttggcggccgaaccttgt
gggccgggcggtgcggcccgcgatgcggcgctgcgaccgatgctgatcggcgacgccgtg
ctgtgtgagcgttacaagcatgcggcatcgctgttcggctggccgcccgtcgacacgatc
gacggcgcggcggcagccggcctgtgggtgctggctgagcgggcggggctgctgcccgcg
gcaagcgaggagggggcgccggttcgtgtcgacgaaccggctgccggaatgagcggccgg
cacgaggatcgacctgcggtcgactcgataccggatcacgaatgccatatttcgggagac
tga

DBGET integrated database retrieval system