KEGG   Burkholderia lata: Bcep18194_C6944Help
Entry
Bcep18194_C6944   CDS       T00286                                 

Definition
(GenBank) Universal stress protein, UspA family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp
Motif
Other DBs
NCBI-ProteinID: ABB05990
UniProt: Q39NH6
Position
3:501655..502128
Genome map
AA seq 157 aa AA seqDB search
MYKKIMVAVDGSASSKQALAEAVKVALAGDAHVSVVYVVDKSVLFTYAGRFDPHALVEEI
RDDGRKVLREAEQIIALAGAKGEAELVETESIGEDIAERLQRYVKECGIDLAVVGTHGRR
GIRRVLLGSVAERFVRGSKCPVLLIRGDDDDVAAAAA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagaagatcatggtggccgtcgacggcagcgcttcgtcgaaacaggcgcttgcc
gaggcagtgaaggtcgcgttggcaggcgacgcgcacgtcagcgtcgtgtatgtggtggac
aagtcggtgctgttcacttacgcgggccgtttcgacccgcacgcactggtcgaggagatc
cgcgacgatgggcgcaaggtgttgcgcgaagcggagcagatcatcgcgctggccggtgcg
aaaggcgaggccgaactcgtcgagaccgaaagcatcggcgaggacatcgcggagcgcctg
cagcgctacgtgaaggaatgcgggatcgatctcgcggtggtcggcacgcacgggcggcgc
gggatccgccgcgtgctgctcggcagcgtcgccgaacgcttcgtgcgcggctcgaagtgc
ccggtgctgctgattcgcggcgacgatgacgatgtcgcggctgcggctgcttaa

DBGET integrated database retrieval system