KEGG   Burkholderia lata: Bcep18194_C6945Help
Entry
Bcep18194_C6945   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2964 CbtA DUF3040 DUF2556 DUF4282
Motif
Other DBs
NCBI-ProteinID: ABB05991
UniProt: Q39NH5
Position
3:502144..502335
Genome map
AA seq 63 aa AA seqDB search
MIRRQYRIVVAAIAVFVSLAGMMAVVSGLLFDNATALRGGAIALVVGVAGFVVMLNPGAK
GEG
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtcgtcagtaccggatcgttgtcgcggcgatcgccgtgttcgtgtcgctcgcg
ggcatgatggccgtcgtgtcggggctgctgttcgacaacgcgacggcgctgcgcggcggc
gcgatcgcgctggttgtcggcgtggccgggttcgtcgtgatgctcaacccgggcgcgaaa
ggcgaggggtga

DBGET integrated database retrieval system