KEGG   Burkholderia lata: Bcep18194_C6946Help
Entry
Bcep18194_C6946   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABB05992
UniProt: Q39NH4
Position
3:502423..502983
Genome map
AA seq 186 aa AA seqDB search
MKTRDLAAIGVVIGAAVLPVLSWAGTAAPPAGFGSHASSGTSATGTSGVSGQHPAADRYG
DHSTDFTDTIGGIDSQGDGIRDDVRAYIDDQYPDPLQRAAMRRYAAVQRDFMMHGDTRAG
AIEGFTRVFRSLECVSRLMGQPGVNQSKIIAAMMSNTRQRFAANGHAMANASGHIYMQSQ
GDPCAQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgagggaccttgcggcgatcggcgtcgtcatcggcgcggccgtgctgcctgta
ttgtcttgggccggaacggcggcaccgccggccggcttcggttcgcatgcgtcgtccggt
acgtcggccacgggcacttccggcgtgtccgggcagcacccggccgcagaccgctacggc
gatcactcgacggatttcaccgatacgatcggcggtatcgactcgcaaggtgacggcatt
cgcgacgacgtccgggcgtacatcgacgatcaatacccggacccgttgcagcgcgcggcg
atgcggcgctacgcggccgtccagcgcgatttcatgatgcacggcgatacgcgtgcaggt
gcaatcgaaggctttacgcgcgtattccgttcgcttgaatgcgtcagtaggctgatgggg
cagccaggcgtcaaccagtcgaaaatcatcgctgcgatgatgtcgaacacgaggcagcgc
ttcgccgccaacggtcatgcgatggcgaatgcgtccgggcacatctacatgcagtctcaa
ggggatccgtgcgcgcagtga

DBGET integrated database retrieval system