KEGG   Burkholderia lata: Bcep18194_C6947Help
Entry
Bcep18194_C6947   CDS       T00286                                 

Definition
(GenBank) TPR repeat protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_2 TPR_1 TPR_14 TPR_10 TPR_16 TPR_8 DUF3856 TPR_4 TPR_9 TPR_21
Motif
Other DBs
NCBI-ProteinID: ABB05993
UniProt: Q39NH3
Position
3:complement(503026..504264)
Genome map
AA seq 412 aa AA seqDB search
MHFRPSVNNTFTNKNRKFMTSRLLAALVAAALSCTALPAAYARTYVAPTASFGKGAYVHQ
FVLRDPATHQPLPNARYRLFLPGQVIAGLPVKPDEHDSVIFGTTDAAGRTVRVRLPKLHP
EKQWVFNPIVGDGDLGESFRLVEPGGSAPIGHFPYVLDVENEYLACGYSDANGYTYYAQS
RTPRNVNLYAGTLAGSADTDWCAGPGLTIANSANAPGAPDLYTQYLGSLVANRDRISSDL
RQQIVAKLLSLAIAEHDEGRVAAALDLDRIPDDRRNDIGYRLADAGVAVERGLAMIDAHL
AESPDDAYALDSKGWALYRLGRNDEALTWFDRSIAIFAKDGDKDKDASEAHAIGLTHKGE
VLWKLGRQDEARDAFAQARKVQPKNEELAETLKRLNVQAIPDSAASPGTTGT
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcatttccggccgtcggtcaataacacctttaccaacaagaaccgcaaattcatgaca
tcccgccttctcgccgcgctcgttgccgcggccttgagctgcaccgccctgcccgccgcc
tacgcgcgcacctacgtcgcgccgacggcgtcgttcggaaaaggcgcttacgttcaccag
ttcgtgctgcgcgaccccgccacgcaccagccgctgccgaatgcgcgctaccggctgttc
ctgcccggtcaggtcatcgcggggctgcccgtcaagccggacgagcatgacagcgtgatc
ttcggcacgaccgacgcggccgggcgcacggtccgggtccggctgccgaagctgcatccg
gagaagcagtgggtgttcaacccgatcgtcggcgacggcgacctgggcgaatcgttccgg
ctagtcgagccgggcggctcggcaccgatcggccatttcccgtacgtgctggacgtggag
aacgaatacctggcgtgcggctattcggatgcgaacggctacacctactacgcgcaatcg
cgcacgccgcgcaacgtcaatctttacgccggcacgctggccgggtcggccgacaccgac
tggtgcgcaggccccggcttgaccatcgcgaacagcgcgaacgccccgggcgcgcctgac
ctgtacacgcaataccttggcagcctggtcgccaaccgcgaccggatcagcagcgatttg
cggcagcagatcgtggccaagctgctgtcgctcgcgatcgcagaacacgacgaggggcgc
gtggccgccgcgctcgatctcgacaggattcccgacgatcgccggaacgacatcggctac
cggctcgccgacgccggcgtcgcagtcgagcgcgggctcgcgatgatcgacgcgcatctc
gcggaatcgccggacgatgcgtacgcgctcgacagcaagggctgggcgctgtatcgcctc
ggtcgcaacgacgaagcgctcacgtggttcgaccgctcgatcgcgatcttcgcgaaggac
ggcgacaaggacaaggacgcaagcgaagcccatgcgatcgggctgacgcacaagggcgaa
gtgctgtggaaactgggacgccaggatgaagcgcgcgatgcgttcgcgcaggcgcggaag
gttcagccgaagaacgaggagctggcggaaacgttgaagcggctgaacgtgcaggcgatc
ccggacagcgcggcgtcgccaggaacgacaggcacgtaa

DBGET integrated database retrieval system