KEGG   Burkholderia lata: Bcep18194_C6953Help
Entry
Bcep18194_C6953   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4132
Motif
Other DBs
NCBI-ProteinID: ABB05999
UniProt: Q39NG7
Position
3:complement(509585..511762)
Genome map
AA seq 725 aa AA seqDB search
MPDRDLAALLVARLTGRADHPRFTGTPIDLSTLDAHSLGAVWPALRRVEHEIMVRDQAFD
DPRAEFARWLHGQIDALGLVPLVDADAALELFRDIPAGEWKRALEELPCLDTLPSPTLQA
ELARIAGEPDEGDVRSGSSTYGVYTLDRFAGRRDFSARRDAYAQALADSPFRVRELDVLP
ALGPAGLLALAATNDGYFAPRRLWLDFSDPAITLAEDAAYVAFARDALTEAAQQVAALHA
GTVPYEADRAFTTDDAQVVARAARVAAYRDEAWLRPLIGPLLTGVCVAPTAAKTAPSQSL
AIALGHAVETIPTPESVRALRDALATVRHAGVQKKLARNLKPAERALGERPHTALRMTLD
AKPDKKQLAMLATCMEAGFWQSMTLGHAEWRERLVDAPAGAAFAARMIWHARSADGSTRS
FMPDIAKGKVVLRDVAGHAIDLAGDSDIRLWHPLLADADERLAWQRAIVGRTLRQPVRQA
FREYYVPADGDTPASDSAMFEGHVLSSRPLVGVARREGWSIRAYDDGLVREFGDVRATFF
VDARLYPGSESHGTSRRLHFERRHDRRWVPLPIGEIDRVVFSEVARAVDLLVSVAAFALD
DDATRAAAAALTVDPVRQRELEAERWQRLNRLSDVPLGTMARHRRHVLSLVFAGPVAQGK
MTIDERHVRVGAWSVHCATGRVMRDGEPVEPAIVPPPSPLRAVPWLPYDEALLQRIVDVV
AGLLD
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcgagacctcgccgcgctgctcgtcgcgcgcctgaccggccgcgccgaccat
ccacgctttaccggcacgccgatcgacctgtcgacgctcgacgcgcactcgctcggcgcc
gtctggccggcattgcgccgggtcgagcacgagatcatggtgcgcgaccaggcgttcgac
gatccgcgtgccgaattcgcgcgctggctgcacgggcaaatcgatgcgcttggactcgtg
ccgctcgtcgacgccgatgccgcgctcgaactgttccgcgatatcccggccggcgagtgg
aaacgcgcgctggaggagttgccctgtctcgacaccctgccgtcgccgacgctgcaagcc
gaactcgcgcgcattgcgggcgaaccggacgaaggcgacgtgcgctcgggatccagcacg
tatggcgtgtacacactcgaccggttcgccgggcgccgcgacttctcggcgcgacgcgac
gcgtatgcgcaagcgctggcggattcgccgtttcgcgtgcgcgaactcgacgtgctgccc
gcactcgggccagcggggctgctcgcactggccgcgacgaacgacggctacttcgcgccg
agacgactgtggctcgacttcagcgatccggccatcacgctcgcggaagacgccgcatat
gtcgcgttcgcgcgcgacgcgctgaccgaggccgcgcagcaggtcgcggcgctccacgcg
ggcaccgttccatacgaagccgatcgtgcgttcacgaccgacgacgcccaggtcgtcgca
cgcgccgcgcgcgtggccgcctatcgcgacgaagcgtggctgcgcccgctgatcgggccg
ctgctgaccggcgtgtgcgtcgcaccgacggccgcgaaaaccgcgccgtcacagtcgctc
gcgatcgcactcggccacgcggtcgagacgatcccgacacccgagagcgtgcgtgcgctg
cgcgacgcgctggccaccgtgcggcatgccggcgtgcaaaagaagctcgcgcgcaacctg
aagccggccgaacgcgcgctcggcgaacggccgcataccgcgctgcgcatgacgctcgac
gcgaagcccgacaagaagcagctcgcgatgctcgccacctgcatggaagccggcttctgg
cagtcgatgacgctcggccatgccgaatggcgcgagcgcctcgtcgatgcgccggccggc
gccgcgttcgccgcacgcatgatctggcacgcgcgcagcgccgatggatcgacgcggtcg
ttcatgccggacatcgcaaagggcaaggtcgtgctgcgcgacgtggccgggcacgcgatc
gacctcgccggcgacagcgacatccggctatggcacccgctgctggccgacgcggacgag
cggctcgcgtggcaacgcgcgatcgtcggccgcacgctgcggcagccggtcaggcaggct
ttccgcgaatactacgtgccggccgacggtgacacgccagccagcgattccgcgatgttc
gaaggccacgtgctgtcgagccggccgctggttggcgtcgcgcgccgcgaaggctggtcg
atccgcgcgtacgacgacgggctggtccgcgaattcggcgacgtgcgcgcgaccttcttc
gtcgatgcgcgtctctatccgggctcggaaagccacggcacgtcgcgccggctgcacttc
gaacgccggcacgaccggcgctgggtgccgctgccgatcggcgagatcgatcgcgtcgtg
ttctccgaagtggcgcgcgcggtcgacttgctcgtgagcgtcgccgcgttcgcgctcgac
gacgacgcaacacgcgcagccgccgccgcgctcacggtcgacccggtgcgccagcgtgag
ctcgaagcggaacgctggcagcgcctgaaccggttgtcggatgtgccgttgggcacgatg
gcgcgccatcgccggcacgtgctgtcgctcgtgttcgccgggccggtggcgcaagggaag
atgacgatcgacgaacgccatgtgcgcgtcggtgcgtggtcggtgcattgcgcgaccggg
cgcgtgatgcgcgacggcgaaccggtcgaacccgcgatcgtgccgccgccgtcaccgctg
cgcgcggtgccgtggctgccttacgacgaagcgctgctgcagcggatcgtcgatgtggtc
gcggggttgctcgactga

DBGET integrated database retrieval system