KEGG   Burkholderia lata: Bcep18194_C6955Help
Entry
Bcep18194_C6955   CDS       T00286                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 HTH_10 DUF2089 HTH_IclR HTH_Tnp_ISL3 HTH_AsnC-type YdaS_antitoxin P22_Cro MarR_2 HTH_5
Motif
Other DBs
NCBI-ProteinID: ABB06001
UniProt: Q39NG5
Position
3:complement(513881..514774)
Genome map
AA seq 297 aa AA seqDB search
MDPIADLEFFARLVTHGSLSALARDLGVTPPAVSARLNQIERRLGVKLLNRTTRRLALTN
EGEVYLATGSKLLEQVHELERTVSSSRNQPQGLLKVNATFGFGRRHIVPALSAFRDRHPE
VEIQLELTDRPMNLAELAYDVGIRFGELPDQRVVGRKLAANRRFVCASPAYLKANGVPKV
PGDLRGHRCIVLRENDTAYGTWHFTKGKRHELVKVHGVMSSNDGEATLRWAIDGHGVLVR
SEWDAQPFIDSGALTRVLADWSLPPSDIYAVYPERLNLSAKVRVFIEFLCEYLERRA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggatccgatcgcagacctggaattcttcgcacggctcgtcacacacggcagcctgtcg
gcgctcgcgcgcgacctcggcgtcacgccgccggccgtcagcgcacggctcaaccagatc
gaacggcgcctcggcgtgaagctgctgaaccgcaccacgcggcggctggcgctcaccaac
gagggcgaggtgtatctcgcaaccggttcgaaactgctcgagcaggtgcacgaactcgag
cgcacggtatcgagcagccgcaaccagccgcaaggcctgctcaaggtcaacgcgaccttc
ggcttcgggcgccgccacatcgtgcccgcgctgtccgcgttccgcgatcgtcatccggaa
gtcgagatccagctcgaactcaccgatcgcccgatgaacctcgccgagctcgcgtacgac
gtggggatccggttcggcgagctgcccgaccagcgcgtggtgggccgcaagctcgcggcg
aaccggcgtttcgtctgcgcgtcgcccgcgtacctgaaagcgaacggtgtgccgaaggtg
cccggcgacctgcgcggccaccgctgcatcgtgctgcgcgagaacgacaccgcgtacggc
acgtggcacttcacgaaaggcaagcgccacgaactcgtcaaggtgcatggcgtgatgagc
agcaacgacggcgaagcgacgctgcgctgggcgatcgacgggcatggcgtgctggtgcgg
tccgagtgggacgcgcaaccgttcatcgattcgggcgcgctgacacgcgtgctcgcggac
tggtcgctgccaccgtcggatatctacgcggtgtatccggaacggctcaacctgtcggcg
aaggtgcgtgtgttcatcgagtttctttgcgagtatctcgagcggcgcgcgtga

DBGET integrated database retrieval system