KEGG   Burkholderia lata: Bcep18194_C6958Help
Entry
Bcep18194_C6958   CDS       T00286                                 

Definition
(GenBank) Citrate carrier protein
  KO
K11616  malate:Na+ symporter
Organism
bur  Burkholderia lata
Pathway
bur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcep18194_C6958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2HCT
Motif
Other DBs
NCBI-ProteinID: ABB06004
UniProt: Q39NG2
Position
3:517037..518359
Genome map
AA seq 440 aa AA seqDB search
MEASPVQTSLPPSTPLAWLLNLKIGGMPLPMFVAIAAVTILAAATKRLPNDMIGGFAVLM
LSGLLLGEIGRRIPVFRHIGGPAILCLFVPSALLGYRLMDDATLKAITVTMKTANLQYLY
IACLVAGSILGMNRKILIQGFLKMFVPLLVGTVAAIAAGIAVGFAFGYDPQHTFFYIVMP
ILGGGIGEGILPLSIGYAEITGAAQGHLIAMMVPAALIGNVVAILASGMLKRFGEKHRRY
SGDGLLVKTGEDRELLAAQQAEARLDLRLMGFGLLLACTLFILGGLLAPLTGIPGPVLMI
VAAAVLKVCRAIPESMEIGAYQMYKFMSTNLTFAILVGLGTLFVSWDKLVGAFSPGYFVI
CASIVIAMVVSGFFVGAALKMYPVESAIITACHSGLGGTGDVAILSSSNRMGLMPFAQIS
TRIGGAAMVVFATIVMKWLH
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaagcttcccccgtgcagacgagcctgccgccgtccacgccgctcgcgtggctgctg
aacctgaagatcggcgggatgccgctgccgatgttcgtcgcgatcgcggccgtcacgatc
ctggcggccgcgacgaagcggctgccgaacgacatgatcggcggcttcgcggtgctgatg
ctgtccgggctgctgctcggcgagatcggccggcggatcccggtgttccggcatatcggc
ggccccgcgatcctgtgcctgttcgtgccgtcggcgctgctgggctaccggctgatggac
gacgcgacgctcaaggcgatcacggtgacgatgaagacggccaatcttcagtatctctac
atcgcgtgcctggtcgccgggagcatcctcgggatgaaccgcaagatcctgatccagggc
ttcctcaagatgttcgtgccgctgctcgtcggtaccgtggccgcgatcgcggccgggatc
gccgtgggcttcgcgttcggctacgacccgcagcatacgttcttctatatcgtgatgccg
atcctcggcggcggcatcggcgagggcatcctgccgctgtcgatcggctatgcggagatc
accggcgccgcgcagggccacctgatcgcgatgatggtgccggctgcgctgatcggcaat
gtcgtcgcgatcctcgcgagcggcatgttgaaacgcttcggcgaaaagcatcgccgctac
agcggcgacggcctgctggtgaagaccggcgaggatcgcgagctgctcgccgcgcagcag
gccgaggccaggctggacctgcggctgatgggcttcggcctgctgctcgcgtgcacgctg
ttcattctcggcgggttgctggcgccgctcacgggcattccggggccggtgttgatgatc
gtcgcggcggccgtgctgaaggtgtgccgcgcgattcccgagtcgatggagatcggcgcg
taccagatgtacaagttcatgtcgacgaacctgacgttcgcgatcctcgtcgggctcggc
acgctgttcgtgtcgtgggacaagcttgtcggcgcgttctcgcccgggtatttcgtgatt
tgcgcgtcgatcgtgatcgcgatggtggtctccggcttcttcgtcggcgccgcgctgaag
atgtatccggtcgaatccgcgatcatcaccgcctgccatagcgggctgggcggcaccggc
gacgtcgcgatcctgtcgtcgtcgaaccggatggggctgatgccgttcgcgcagatctcg
acacgcatcggcggcgccgcgatggtcgtgttcgcgacgatcgtgatgaagtggctgcat
tga

DBGET integrated database retrieval system