KEGG   Burkholderia lata: Bcep18194_C6959Help
Entry
Bcep18194_C6959   CDS       T00286                                 

Definition
(GenBank) Major facilitator superfamily (MFS_1) transporter
  KO
K08369  MFS transporter, putative metabolite:H+ symporter
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bur02000]
    Bcep18194_C6959
Transporters [BR:bur02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    Bcep18194_C6959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF2950
Motif
Other DBs
NCBI-ProteinID: ABB06005
UniProt: Q39NG1
Position
3:complement(518462..519901)
Genome map
AA seq 479 aa AA seqDB search
MHQTVTAGGAPLDTPQVRAGIRAGADISARMDRLPITRHQWMLVLLISLGGFFEVYDLIF
TGYIAPGMAKSGLLQTTTQAFFGFTGIAAFIAATFAGLFVGTFGFGWMPDRYGRRAVFTY
SLLWYSIGSAIMAFQTTPEGVLLWRFITGIGVGLEIVTIDTYVTELVPQHMRGRAIAFNQ
VVMFAAAPVAAILSWWLVPTTVFGLDGWRVVVLAGSAGAVIVWFIRRAVPESPRWLAAHG
DAERSERIVSRMEAIAERESGMPLPPPAPASEAPEVHRAAFAALWRAPYRARLLMLVAFN
FCQAIGYYGFANWVPTLLIGQGITVTKSLLYAFVIAFAMPAGPLLAMRYADRIQRKHLIV
GGALAVIACGLAFAQVKTVAPLIVLGVLISLAGQTISVAYHAYQCELFPTEVRSRASGIA
YSASRAGAMMSGFIIAALLKDFGVSGVFTGITVFMLVVVIVIGTFGPRTNGVRLEELNR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagaccgtcaccgcgggcggcgccccgctcgatacgccgcaggtacgcgccggc
atccgcgccggcgcggacatctccgcgcgcatggaccggctgccgatcacgcggcaccag
tggatgctcgtgctgctgatttccctcggcggcttcttcgaagtctacgacctgatcttc
actggctacatcgcaccgggcatggcaaaaagcggcctgctgcagaccaccacgcaggca
ttcttcggcttcaccggcatcgccgccttcatcgcggcgaccttcgcggggctgttcgtc
ggcacgttcggcttcggctggatgccggaccgctacgggcgccgcgccgtcttcacgtac
tcgctgctgtggtactcgatcggctcggccatcatggcgttccagacgacgcccgagggc
gtgctgttgtggcgcttcatcaccggcatcggcgtcgggctcgagatcgtcacgatcgac
acctacgtgaccgaactcgtcccgcagcacatgcggggccgcgcgatcgcgttcaaccag
gtcgtgatgttcgccgccgcgccggtcgcggcgatcctgtcgtggtggctcgtgcccacg
acggtattcgggctcgacggctggcgcgtcgtggtgctggccggctcggccggcgccgtg
atcgtctggttcatccgtcgtgcggtacccgaaagcccacggtggctggccgcgcacggc
gatgccgaacgaagcgaacggatcgtgagccggatggaagcgatcgccgagcgcgaatcg
ggcatgccgctgccgccgcccgcgccggcaagcgaggctcccgaagtacaccgcgcggcg
ttcgcagcattgtggcgcgcaccctatcgcgcccgcctgctgatgctcgtcgcgttcaac
ttctgccaggccatcggctactacggattcgcgaactgggtgccgacactgttgatcggc
cagggcatcaccgtcacgaagagcctgttgtatgcgttcgtcatcgcattcgcgatgccg
gccgggccgctgctcgcgatgcgctatgcggaccggatccagcgcaagcacctgatcgtc
ggcggtgcgctggccgtgatcgcctgcgggctcgcgttcgcgcaggtcaagaccgttgcg
ccgctcatcgtgctcggcgtgctgatcagcctcgccgggcagacgatctccgtcgcctat
cacgcgtaccagtgcgagctgtttccgaccgaggtgcgctcccgcgcgagcggcatcgcg
tattcggccagccgcgccggcgcgatgatgtcgggcttcatcatcgcggcgctgctgaag
gatttcggcgtgtccggcgtgttcaccgggatcaccgtgttcatgctcgtcgtggtcatc
gtcatcggcacgttcggcccgaggaccaacggcgtgcggctcgaggagctcaatcgctga

DBGET integrated database retrieval system