KEGG   Burkholderia lata: Bcep18194_C6970Help
Entry
Bcep18194_C6970   CDS       T00286                                 

Definition
(GenBank) protein of unknown function UPF0187
  KO
K08994  ion channel-forming bestrophin family protein
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bur02000]
    Bcep18194_C6970
Transporters [BR:bur02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcep18194_C6970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bestrophin Xin
Motif
Other DBs
NCBI-ProteinID: ABB06016
UniProt: Q39NF0
Position
3:530668..531588
Genome map
AA seq 306 aa AA seqDB search
MIVRPQQNWLRMLFVWNGSVLQSIIPQLVFMAIVSTLAVFTNGRIFGEKIPLNTAPFTLF
GLALAIFLGFRNSASFERFKEARHLWGNLLIAARTLTSQFNRYLPDSVNDAERNRLADLL
IALTYALKHQLRHTDPTADLQRILGAERTTELGGKCFKPVAILDELRGGIVRALGRAPGS
DATCWMFETQLDEVGKSVGGCERILSTPIPFSYSVLLHRTVYAYCVLLPFGLVDSTEFFT
PLICVFISYTLIALEAIASEVAEPFGLAPNALALDAMTRTIERSVLELGDRPLPEEFMPA
STYQIT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtccgaccacaacaaaactggctcaggatgctgttcgtctggaacggctccgtg
ctgcaatcgatcattccgcagctcgtgttcatggcgatcgtcagcacgctggcggtcttc
acgaacgggcgcatcttcggcgagaagatcccgctcaacaccgcgccgttcacgctgttc
gggctcgcgctcgcgatctttctcgggtttcgcaacagcgcgagcttcgagcgcttcaag
gaggcgcggcatctgtggggcaacctgctgatcgcggcgcgcacgctgacgtcgcagttc
aatcgctacctgcccgacagcgtgaacgacgccgagcgcaaccggctggccgacctgctg
atcgcgctcacctatgcgctgaagcatcagcttcgccataccgatccgacggcggacctg
cagcgcattctcggtgcggaacgcacgaccgagcttggcggcaaatgcttcaagcccgtc
gcgatcctcgacgagctgcgcggcggcatcgtccgcgcgctgggccgtgcgcccggtagc
gacgcgacctgctggatgttcgagacgcaactcgacgaggtcggcaaatcggtcggtggt
tgcgagcgcatcctgtcgacgccgattccgttctcgtacagcgtgctgctgcatcgcacc
gtgtatgcgtactgcgtgctgctgccgttcggcctcgtcgattcgacggagttcttcacg
cctctgatctgcgtgttcatctcgtacacgctgatcgcgctcgaagcgatcgcgagcgag
gtggccgagccgttcggcctcgcgccgaatgcgctggcgctcgatgcgatgacgcgcacg
atcgagcggtcggtgctcgaactgggcgaccgcccgctgccggaggaattcatgccggcg
tcgacgtaccagatcacctga

DBGET integrated database retrieval system