KEGG   Burkholderia lata: Bcep18194_C6975Help
Entry
Bcep18194_C6975   CDS       T00286                                 

Definition
(GenBank) tryptophanyl-tRNA synthetase
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
bur  Burkholderia lata
Pathway
bur00970  Aminoacyl-tRNA biosynthesis
Module
bur_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bur00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bcep18194_C6975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bur01007]
    Bcep18194_C6975
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bur03016]
    Bcep18194_C6975
Enzymes [BR:bur01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     Bcep18194_C6975
Amino acid related enzymes [BR:bur01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Bcep18194_C6975
Transfer RNA biogenesis [BR:bur03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Bcep18194_C6975
 Prokaryotic Type
    Bcep18194_C6975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: ABB06021
UniProt: Q39NE5
Position
3:complement(533909..534922)
Genome map
AA seq 337 aa AA seqDB search
MTHPARPTILTGDRTTGPLHLGHYIGSLRARVQMQHEAKQFLLLADTQALTDNMGRRQRV
TENVIEVALDYLAVGIDPAISTIVVQSQVPELAELSQYLLNLVTVARLERNPTIKEEIRL
RGFERDIPAGFLTYPVSQAADITAFKATHVPVGDDQLPMIEQTNELVRRFNATVEQPVLV
ECEAVLSPVTRLPGIDGKAKMSKSLGNAITLGSTPDEITQAVKDMYTDPNHLRVSDPGQV
EGNVVFTFLDAFEPDVQKVDELKAHYRRGGLGDSVVKRVLDERLQALIEPIRARRREFEA
DKAEVMAILKRGTMHARDVAGATLAEVKGAMGLNYFD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacccatcccgcccgcccgaccatcctcaccggtgaccgcacgaccggcccgctgcat
ctcggccactacatcggctcgctgcgcgcccgcgtgcagatgcagcacgaagcgaagcag
ttcctgctgctcgccgacacgcaggcgctgaccgacaacatgggccgccgccagcgcgtc
accgagaacgtgatcgaagtcgcgctcgactatctcgcggtcggcatcgatccggcgatc
tcgacgatcgtcgtgcagtcgcaggtgcccgagctcgccgagctgtcgcaatacctgctg
aacctcgtcacggtcgcgcgcctcgaacgcaacccgaccatcaaggaagagatccgcctg
cgcggtttcgagcgtgacatcccggccggcttcctgacctacccggtgagccaggcggcc
gacatcaccgcgttcaaggcgacccacgtgccggtcggcgacgaccagttgccgatgatc
gagcagaccaacgaactcgtgcgccgcttcaacgcgaccgtcgagcagccggtgctggtc
gaatgcgaggccgtgctgtcgccggtcacgcgtctgccggggatcgacggcaaggccaag
atgagcaagtcgctcggcaacgcgatcacgctcggctcgacgccggacgagatcacgcag
gccgtgaaggacatgtacacggacccgaaccacctgcgcgtgagcgatcccggccaggtc
gagggcaacgtcgtgttcacgttcctcgatgcgttcgagcccgacgtgcagaaagtcgac
gagctgaaggcgcactaccgtcgaggtgggctcggcgacagcgtcgtcaagcgcgtgctg
gacgagcggctgcaggcgttgatcgagccgatccgcgcgcgccgccgcgaattcgaggcc
gacaaggccgaagtgatggcgatcctcaagcgcggcacgatgcacgcacgcgacgtggcc
ggcgcgacgctcgcggaggtgaagggcgcgatggggttgaactacttcgattga

DBGET integrated database retrieval system