KEGG   Burkholderia lata: Bcep18194_C6982Help
Entry
Bcep18194_C6982   CDS       T00286                                 

Definition
(GenBank) sigma-24 (FecI-like)
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bur03021]
    Bcep18194_C6982
Transcription machinery [BR:bur03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Bcep18194_C6982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 Sigma70_r2
Motif
Other DBs
NCBI-ProteinID: ABB06028
UniProt: Q39ND8
Position
3:539078..539635
Genome map
AA seq 185 aa AA seqDB search
MTTSNQHAAPTPECPAQQLDRTWREMQGKLRRRARLLCKGDIHRADELLSDTALKVHIYL
QRSPERVQNLAGFLFLVLNHAFLDGARRRLRESGMLEFDPGWDDDHTVELAGHAPSVEQQ
MLLRQQLVRLQQALSTLPPQQQMLFTLKFEEDRPYLHIAATLGINEPLARKRVELLRKKL
REELA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctcgaaccagcacgctgccccgacgcccgagtgtccggcgcagcaactcgat
cgcacgtggcgggagatgcagggaaaattgcggcgccgcgcgcgcctgttgtgcaagggc
gatattcaccgcgccgacgaactgctctccgataccgcactcaaggtccacatttacctg
cagcgctcgcccgagcgcgtgcagaacctggccggttttctctttctggtgctgaaccac
gcattcctcgatggcgcacggcgccggctgcgcgaaagcgggatgctcgaattcgacccg
ggctgggacgacgatcacaccgtcgagctggccggccacgcgccgtcggtggagcagcag
atgctgcttcgacagcagttggtgcgtctccagcaggcgctgtccacgctgccccctcag
cagcagatgctgttcacgctcaagttcgaggaagaccgcccctatctgcacatcgcggcg
acgctcgggatcaacgagccgcttgcgcggaagcgtgtcgagttgttgcgcaagaagttg
cgcgaggaactcgcgtaa

DBGET integrated database retrieval system