KEGG   Burkholderia lata: Bcep18194_C7118Help
Entry
Bcep18194_C7118   CDS       T00286                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bur  Burkholderia lata
Pathway
bur00071  Fatty acid degradation
bur00072  Synthesis and degradation of ketone bodies
bur00280  Valine, leucine and isoleucine degradation
bur00310  Lysine degradation
bur00362  Benzoate degradation
bur00380  Tryptophan metabolism
bur00620  Pyruvate metabolism
bur00630  Glyoxylate and dicarboxylate metabolism
bur00640  Propanoate metabolism
bur00650  Butanoate metabolism
bur00900  Terpenoid backbone biosynthesis
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01200  Carbon metabolism
bur01212  Fatty acid metabolism
bur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep18194_C7118
   00630 Glyoxylate and dicarboxylate metabolism
    Bcep18194_C7118
   00640 Propanoate metabolism
    Bcep18194_C7118
   00650 Butanoate metabolism
    Bcep18194_C7118
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_C7118
   00072 Synthesis and degradation of ketone bodies
    Bcep18194_C7118
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcep18194_C7118
   00310 Lysine degradation
    Bcep18194_C7118
   00380 Tryptophan metabolism
    Bcep18194_C7118
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcep18194_C7118
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep18194_C7118
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcep18194_C7118
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bur04147]
    Bcep18194_C7118
Enzymes [BR:bur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcep18194_C7118
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcep18194_C7118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABB06162
UniProt: Q39N04
Position
3:complement(690788..692059)
Genome map
AA seq 423 aa AA seqDB search
MRAAAPTWRTAMPVNHSSFNYRIETTMIRSAVIVDAVRSPMGRTKAGGAFVQLHPADLLS
QVIQALVARNDLDPGTVDDVMIGCVSQVGEQSTTPGRVAWLAAGFPAHVPATTIERKCGS
SQQAIHFAAQAIMAGVNDIVIAGGVESMSRVPMGSARIDRDPYGARFHARFPQGLVGQGV
SADLVAQKWDLSREALDAYSAESHRRAEAARTAGQFAREIVPIDVPGDGGLRRVDTDETI
RVGTSVERLASLAPSFENAELAQRFPGIRWNVTAGNASQISDGAAALLVMSEQKAARLGL
KPRARIVAFDVCGDDPLMMLTAPIPATERLLKRQGLSVHDIDRFEVNEAFAAVPLAWQKA
LGADGARLNAAGGAIALGHPLGASGARLMTTMLNSLEASGGRYGLQTMCEAGGMANATLI
ERL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgcggcaccgacgtggcggaccgccatgcccgtcaatcattcttcgtttaac
tatcgtatcgagacaaccatgatcagaagcgcggtaatcgtagacgcagtacgcagtccg
atggggcgtaccaaggccggcggcgccttcgtccagctgcatccggccgacctgctttcg
caggtgatccaggccctggtcgcgcgcaacgatctcgatcccgggaccgtcgacgacgtg
atgatcggctgcgtgagccaggtcggcgagcaatcgacgacacccggtcgcgtcgcgtgg
ctggcggcggggtttccggcccacgttccggccacgacgatcgagcggaagtgcggatcg
agccagcaggcgattcacttcgcggcgcaggcaatcatggccggcgtgaacgacatcgtg
atcgccggcggcgtcgaatcgatgagccgcgtgccgatgggttccgcgcgcatcgaccgc
gatccgtacggtgcccgctttcatgcgcggtttccgcaggggctggtcggtcagggtgtc
agcgccgatctcgttgcgcagaagtgggatctgtcacgcgaagcactcgacgcgtactcg
gccgagtcgcatcgtcgtgccgaggccgcgcgcacggccggccagttcgcccgcgagatc
gtgccgatcgacgtacccggcgacggtggcctccggcgcgtggatacggacgagacgatc
cgtgtgggcacgagcgtcgagcgtctcgcgagcctcgcgccttcgttcgagaacgccgag
ctggcgcaacggttcccgggcattcgctggaacgtgacggccggcaacgcatcgcagatt
tccgacggcgctgccgcgctgctcgtgatgagcgagcagaaggcggcgcggctcgggctc
aagccgcgtgcgcggatcgtcgcgttcgacgtgtgcggggacgatccgctcatgatgctg
accgcgccgattcccgcgaccgaacggctgctgaaacggcagggactgtcggtgcacgac
atcgaccgtttcgaggtgaacgaggcgtttgcggcggtgccgctggcctggcaaaaggcg
ctgggtgccgatggtgcgcgactgaatgcggcgggcggcgccattgcgctcgggcatccg
ctgggcgcgtcgggcgcgagactgatgaccacgatgctcaattcgctggaagcatcgggg
gggcgatatggattgcagacgatgtgcgaggccggcgggatggcgaacgcgacattgatc
gaacgcttgtga

DBGET integrated database retrieval system