KEGG   Burkholderia lata: Bcep18194_C7333Help
Entry
Bcep18194_C7333   CDS       T00286                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bur  Burkholderia lata
Pathway
bur00010  Glycolysis / Gluconeogenesis
bur00620  Pyruvate metabolism
bur00640  Propanoate metabolism
bur00680  Methane metabolism
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_C7333
   00620 Pyruvate metabolism
    Bcep18194_C7333
   00640 Propanoate metabolism
    Bcep18194_C7333
  Energy metabolism
   00680 Methane metabolism
    Bcep18194_C7333
Enzymes [BR:bur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcep18194_C7333
Lipid biosynthesis proteins [BR:bur01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcep18194_C7333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABB06377
UniProt: Q39MD9
Position
3:932362..934314
Genome map
AA seq 650 aa AA seqDB search
MSHPESGQTWQPGQRELQNAGIVKLMRALDVSSYDELMRVSIAEPERYWDTVMRECAIAW
DVPPTGYVDLSRGAQFPSWFPGGKLNWVNTIYAWARHPATAQQKAVVAEREDGSVSTLTF
AELEQRVQDFAAGLARHGVKQGDRIGLLMENGVEATVSLLAIVHLGALVVPLFSGFGVDA
IVARLSAAEARMVIASTGFSRRTKRVDVQGALRDAWRQLPLLEHVIWKRGEGDTAQDARD
LDWQETAAAAPEQRSAAVSVTPDTPFMVIYTSGTTGKPKGVVHTHGSFPIKIAHDSLIHF
DVQPGDVYCWPADMGWIAGTLVLGCALLRGATLVCYDGAPDYPDWSRMSRVVERHRVTHF
GSAPTLIRGMASHEALALAGDRSTVRLLITAGEGIAPEHFNWFLQRFGDGTAPVINYTGG
TEASGALLASVPIRPIPPSGFNTVSPGVAADVVNADGQSVTGEVGELAIRAPFVGMTHSF
WRDDERYLETYWQTIPGIWVHGDLALRTPDGNYFMMGRSDDTLKVAGKRLGPAEVEEVVL
ELHDVAEAAAIGVADADKGQKLVVFIVPKPGTAVAVAELETLVSGHVDKRLGRPFRPGRV
HVVAQLPKTRSSKIMRRVIRSVYCGQPPGDLSSLDNPAALDEVRAASTVS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccctgaatccggccagacctggcaaccgggccagcgcgagctgcagaacgcc
ggcatcgtgaagctgatgcgcgcgctggacgtgtcgtcgtatgacgagctgatgcgcgtg
tcgatcgccgagcccgaacgctactgggacaccgtgatgcgcgaatgcgcgatcgcgtgg
gacgtgccgccgaccggctatgtcgacctgtcgcgcggcgcgcagtttccgagctggttc
cccggcggcaagctcaactgggtcaacacgatctacgcgtgggcacggcatcccgccacg
gcgcagcaaaaagccgtggtggccgaacgcgaggacggcagcgtcagcacgctgaccttc
gcggagctggagcagcgcgtgcaggatttcgccgcggggctcgcgcgtcacggcgtcaag
cagggcgaccgcatcggcctgctgatggaaaacggcgtcgaggccaccgtctcgctgctg
gccatcgtgcacctcggcgcgctggtcgtgccgctgttcagcggcttcggcgtcgacgcg
atcgtggcccgcctgtccgccgccgaagcgcggatggtgattgcctccaccggcttctcg
cgccgcaccaagcgcgtggacgtgcaaggcgcactgcgcgacgcatggcgccagttgccg
ctgctcgaacacgtgatctggaaacgcggcgaaggcgacaccgcgcaggacgcacgcgac
ctcgactggcaggaaaccgcggccgccgcccccgagcaacgcagcgccgccgtgtcggtc
acgcccgacacgccgttcatggtgatctacacgtcaggcaccacgggcaagcccaagggc
gtcgtgcatacacacggcagcttcccgatcaagatcgcgcacgattcgctgatccacttc
gacgtgcagccgggcgacgtctattgctggccggccgacatgggctggatcgccggcacg
ctggtgctcggctgcgcgctgctgcgcggcgcgacgctggtgtgctacgacggcgcgccc
gactaccccgactggtcgcgcatgtcgcgcgtggtcgaacgtcaccgcgtcacgcacttc
ggctcggcgcccacgctgatccgcgggatggcgagccacgaggcactggcgctcgcgggc
gaccgctccacggtacggctgctgatcaccgccggcgaaggcatcgcgcccgagcatttc
aactggttcctgcaacgcttcggcgacggcacggcgcccgtcatcaactacacgggcggc
accgaggcatcgggcgcgctgctcgcgagcgtgccgatccggccgattccgccgagcggc
ttcaacaccgtgtcgccgggcgtggccgccgacgtcgtgaatgccgatggccagagcgtg
accggcgaagtcggcgagctggcgatccgcgcgccgttcgtcggcatgacgcattcattc
tggcgcgacgacgagcgctacctggaaacctactggcagaccattccgggcatctgggtg
catggcgatctcgcgctgcgtacacccgacggcaactacttcatgatgggccgctccgac
gacacgctgaaggtcgccggcaagcggctcgggccggccgaggtcgaggaagtcgtgctg
gagctgcacgacgtggccgaagcggccgcgatcggcgtggcggatgccgacaagggccag
aaactggtggtcttcatcgtgcccaagcccggcacggctgtcgcggttgccgagctggaa
acgctcgtgtccggtcacgtcgacaagcggctgggccgcccgttccggcccggccgcgtg
cacgtggtcgcgcaactgccgaagacgcgcagctccaagatcatgcggcgcgtgatccgc
agcgtgtattgcgggcagccgccgggcgacctgtcgtcgctggacaatcccgccgcgctc
gacgaagtgcgcgcggcctcgaccgtctcctga

DBGET integrated database retrieval system