KEGG   Burkholderia lata: Bcep18194_C7342Help
Entry
Bcep18194_C7342   CDS       T00286                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bur  Burkholderia lata
Pathway
bur00010  Glycolysis / Gluconeogenesis
bur00053  Ascorbate and aldarate metabolism
bur00071  Fatty acid degradation
bur00280  Valine, leucine and isoleucine degradation
bur00310  Lysine degradation
bur00330  Arginine and proline metabolism
bur00340  Histidine metabolism
bur00380  Tryptophan metabolism
bur00410  beta-Alanine metabolism
bur00561  Glycerolipid metabolism
bur00620  Pyruvate metabolism
bur00625  Chloroalkane and chloroalkene degradation
bur00903  Limonene and pinene degradation
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
Module
bur_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_C7342
   00053 Ascorbate and aldarate metabolism
    Bcep18194_C7342
   00620 Pyruvate metabolism
    Bcep18194_C7342
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_C7342
   00561 Glycerolipid metabolism
    Bcep18194_C7342
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcep18194_C7342
   00310 Lysine degradation
    Bcep18194_C7342
   00330 Arginine and proline metabolism
    Bcep18194_C7342
   00340 Histidine metabolism
    Bcep18194_C7342
   00380 Tryptophan metabolism
    Bcep18194_C7342
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcep18194_C7342
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcep18194_C7342
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcep18194_C7342
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Bcep18194_C7342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABB06386
UniProt: Q39MD0
Position
3:943846..945342
Genome map
AA seq 498 aa AA seqDB search
MLSLVSHLDHLNVRPGRLFIDGQWLDWPDARFDQLNPCTNEVMTSFADAGAQGVELAVAA
ARKAFDEGPWPRMRAQDRKRLLQPIVERLYAAEEEIARLQTLDNGIPYAFSRHSRVSAKS
AADVFDHFLGWIDKINGDTLPIFSGASNMQYMTFRDPVGVVAAVLPYNGPVLTFAMKVAP
ALACGCTVIVKSSELTNLAVARLAQIIADSDLPPGVFNFVTGGVETGSALTSHAGVDKVT
FTGSPAVGEKIMIASAPTMKRLSLELGGKSAALVFPDTRSVQTTAHALMGLCSTFLSGQV
CSTPSRAVVHRSIMDEFLHHAQEQLQKVRFGDPFDAATTSAPMISRRHQARVLDYVESGR
QQGATLLAGGRAPGGEFRNGNWVEPALFANVSNDMTIAQEEIFGPVLSVIPFDTEEEAIR
IANDSAYGLAGCVYTTDVSRAFRVARAVKSGAIGVNGFASIPNAPFGGIKRSGTGREGGW
STIEAFTELKTVNFNLDA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtctcgtttcccatctcgaccacttgaacgtccgccccggacgccttttcatc
gatggccaatggctggactggcccgacgcgcgtttcgaccagctcaacccctgcacgaac
gaagtcatgaccagcttcgccgacgccggcgcgcaaggcgtggagctggccgtggccgcg
gcgcgcaaggcattcgacgaaggtccgtggccgcgcatgcgcgcgcaggaccgcaagcgc
ctgctgcagccgatcgtcgagcgcctgtatgcggccgaggaagaaatcgcgcggctgcaa
acgctcgacaacggcattccgtacgcgttcagccgccattcgcgcgtctccgccaagtcg
gccgccgacgtcttcgatcacttcctcggctggatcgacaaaatcaacggcgacacgctg
ccgatcttctccggtgcgtcgaacatgcagtacatgaccttccgcgacccggtcggcgtg
gtcgcggccgtgctgccgtacaacggccccgtgctgacgttcgcgatgaaggtggcgccg
gcgctggcctgcggctgcaccgtgatcgtcaagtcgtcggagcttaccaacctcgccgtg
gcccggctcgcgcagatcatcgccgacagcgacttgccgcccggcgtgttcaacttcgtg
accggcggcgtcgaaacgggtagcgccctcacctcgcacgccggcgtcgacaaggtgacc
ttcaccggcagcccggccgtcggcgaaaaaatcatgatcgcgagtgcgccgacgatgaaa
cgcctgtcgctggaactgggcggcaagagcgcggcgctcgtctttcccgacacgcgcagc
gtgcagaccaccgcgcacgcgctgatggggctgtgctccacgttcctgtcgggacaggtc
tgctccacgccgtcgcgcgcggtcgtgcatcgctcgatcatggacgagttcctgcaccac
gcgcaggaacagctgcagaaggtgcggttcggcgatccgttcgacgcggccaccacgtcg
gcgccgatgatttcccggcgccaccaggcgcgcgtgctcgactacgtcgaaagcggccgc
cagcaaggcgcgacgctgctggcgggcggccgcgcgccgggtggcgaattccgcaacggc
aactgggtcgagccggccctcttcgccaacgtgagcaacgacatgacgatcgcgcaggag
gaaatcttcggccccgtgctgtcggtgattccgttcgacaccgaggaggaagcgatccgc
atcgccaacgacagcgcgtacgggctggccggctgcgtgtacaccacggacgtgagccgc
gcgttccgcgtcgcgcgtgcggtcaagagcggcgcaatcggcgtcaacggctttgccagc
attccgaatgcgccgttcggcggcatcaagcgctcgggcacgggacgcgaaggcggctgg
tcgacgatcgaagcgtttaccgaactgaaaaccgtcaatttcaatctggatgcctga

DBGET integrated database retrieval system