KEGG   Burkholderia lata: Bcep18194_C7609
Entry
Bcep18194_C7609   CDS       T00286                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bur  Burkholderia lata
Pathway
bur03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep18194_C7609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_C7609
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_C7609
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: ABB06653
UniProt: Q39LL3
Position
3:complement(1247197..1250040)
AA seq 947 aa
MSTNMDVLKKLAGDWSQYDRFLWVTTPLGANALVAESLHGWEAVDHGGYRFQLTALSGNA
ALPLERLIGAPILVEWRAREGSDVRRPVHGHIIAAERIGYNGGLARFRLEVEPWLAVLRQ
RVDHYNFQNASVLDISEQIFGYHTAGTVAPAWRWALADPARYRKRSLTTQAGESDFDFLQ
RLWAEEGIFYWFEHAGDAHTSSLGKHTLVLADSNQHFTPDKPEVIGFHQTSDGDPAGSIQ
HFMTARRWRIGRVARASWDHRTLSNRLTGAQADGVAMAGEDRDVAGPYAFQTAALGDQRA
RQQLDAQRVAALCSEGRSTCMALHPGMRFAISGHPALKASDAFVCLRVQHSVRANVDADV
HAAIEQTLGDIPPMLDTDVNEYGVAHALHAALGSGTHDGAPLVGNEAVYANSFVALPAGQ
TYRPLSEGGHGARSHPVVAVQGAQTAIVVGAGDPVHTDRDHRVRIQHHAQRGQKAASLED
HPHAANAPADRNAGTWTRVLTPVGGDNWGGVTVPRVGQEVWTDWLEGQPDRPVVVGSLYN
GQGNADAQHNAQAGGPASSTGNAAAWFAGNGHPAALTGIKTQDLNLSQQGTGGYRQFLLD
DTAGEASARLYTTDHNSGLTLGHLKQIQDNQRQADRGYGMELTTDAAAALRGGSGMLVSA
ARGASQMDASAAGQVLTQNRQLLDGLAEAARAQGAEPAQPAASVGAGADDAGHATGPGTS
TQSAAVTGLQQSEQALAEKRDGRTSAQAGGGSGSAAAWSRPHVVAHGADGLAAVTPGSQV
WVSGTETVLSAGQDLQWTAKGKTTLAATHGVAFYTQGNAAGERPVAGQGIALHAASGAVS
LQAQNAGTLGAAAQQAVVLSSSQGAANLQAPKRLLLNAAKAYLKMEGGNIEVGAPGRVEF
KSAQRELTGPRGAGGQTSLGSSSAKDCQLRLSGAAASHDSVVMLPAG
NT seq 2844 nt   +upstreamnt  +downstreamnt
atgtcgacgaatatggacgttctgaaaaaactcgccggagactggtcgcagtacgaccgg
tttctctgggtcaccacgccgctgggcgcgaacgcgctggtcgccgagagtctgcacggg
tgggaggcggtcgatcacggcggctaccggtttcagttgacggcattgtccgggaacgcg
gcgttgccgctggagcgcctgatcggcgcgccgatcctggtcgaatggcgtgcgcgtgaa
ggcagcgacgtccgccgccccgttcacggtcacatcattgcggcggagcggatcggctac
aacggcgggctggcccgctttcgtctcgaagtcgagccgtggctcgcggtgctccgccag
cgcgtcgatcactacaatttccagaacgccagcgtgctcgacatcagcgagcagattttc
ggctatcacaccgcgggcaccgtggcacccgcgtggcgctgggcgctggccgatcccgcc
agataccgcaagcgcagcctgaccacccaggccggtgaatccgacttcgatttcctgcag
cggctgtgggccgaagagggcatcttctactggttcgagcatgccggcgacgcccatacg
tccagcctcggcaagcacacgctcgtgctcgccgattcgaaccagcacttcacgccggac
aagccggaggtcatcggctttcaccagacgagcgacggcgatccggcgggcagcatccag
catttcatgaccgcgcgtcgctggcggatcggccgggtcgcacgcgcgagctgggatcac
cgcacgctgtcgaaccggttgaccggcgcgcaggccgacggcgtcgcgatggctggcgaa
gatcgtgacgttgccggcccgtatgcgttccagaccgccgcactcggcgatcagcgcgcg
cgccagcaactcgacgcgcaacgcgtcgccgcgctgtgcagcgaagggcgcagcacctgc
atggcgctgcatccgggaatgcgtttcgcgatcagcgggcatccggcgctgaaggcgtcg
gacgcgttcgtgtgcctgcgcgttcagcacagcgtgcgcgcgaacgtcgatgcggacgtg
cacgccgcgatcgagcagacgctcggcgacataccgccgatgctggataccgacgtgaac
gagtacggcgtcgcccatgcgctgcacgccgcgctcggcagcgggacgcacgatggcgcg
ccgctggtgggcaacgaagcggtctatgcgaacagcttcgtcgcgttgccggccggacag
acgtaccggccgctgagcgaaggcggtcacggcgcacgctcgcatcccgtggtggccgta
cagggtgcgcaaacggcgatcgtcgtcggcgcgggcgatccggttcacaccgatcgcgat
caccgggtccggatccagcaccatgcgcagcgcgggcagaaggccgcgagtctcgaggat
catccgcacgcggccaacgcgccggccgaccggaatgccggcacatggacacgcgtgctg
acgccggtcggcggcgacaactggggcggcgtgaccgtgccgcgcgtcgggcaggaagtg
tggaccgactggctcgaggggcaaccggaccggccggtggtggtgggttcgctgtacaac
ggccagggcaatgccgatgcgcagcacaacgcgcaagcgggcggtccggccagcagtacc
ggcaatgcggccgcgtggttcgcaggcaatggccaccccgcggcactgacgggcatcaag
acgcaggacctgaacctgagccagcaagggacgggcggctatcggcagttcctgctcgac
gacacggccggcgaggcgagtgcgcgtctttatacgacggaccacaacagcgggttgacg
ctgggtcatctcaagcagattcaggacaaccagcggcaagccgatcgcgggtatggcatg
gagttgacgaccgacgctgccgctgcgttgcgcggcggctcgggcatgctcgtcagcgcg
gcgcgtggcgccagccagatggacgcgagtgcggcgggccaggtgctgacccagaaccgt
caactgctcgacggcctcgcggaggcggcgcgcgcgcaaggtgccgagccggcacagccc
gcggcaagcgtcggcgcgggggcggatgacgcggggcatgcgacggggcccggcacgtcg
acgcaatcggccgccgtgaccgggttgcagcagagcgagcaggcgctggccgaaaagcgc
gacggccgaacgtctgcccaggccggcggcggaagcggtagcgctgccgcatggtcgcgt
ccgcatgtcgtcgcgcatggcgcggacggtctcgccgccgtgacgcccggcagccaggtc
tgggtgtcggggacggagaccgtgctgagcgccggccaggatctgcaatggacggccaag
ggcaagacaaccctggcggcgacgcacggcgtcgcgttctatacacagggcaacgccgcg
ggcgagcggcccgtcgccgggcaaggcatcgcgttgcacgcggcctccggcgcggtaagc
ctgcaggcgcagaatgcgggcacgctcggcgcggccgcgcagcaggcggtcgtgctgtcg
agcagccagggcgcggcgaatctgcaggcaccgaagcgtctgctgctgaatgccgcgaaa
gcgtacctgaagatggagggcggcaatatcgaggtcggcgcgccggggcgggtggaattc
aagtcggcgcagcgcgaactgaccgggccgcgaggcgcgggcgggcaaacctcgttgggc
agcagcagcgcgaaggattgccagttgcgcctgtcgggcgcggccgcgagccacgacagc
gtcgtcatgctgccggcgggctga

DBGET integrated database retrieval system