KEGG   Burkholderia pseudomallei TSV202: X994_1198Help
Entry
X994_1198         CDS       T03428                                 

Definition
(GenBank) NAD(P)H binding domain of trans-2-enoyl-CoA reductase family protein
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00061  Fatty acid biosynthesis
but00650  Butanoate metabolism
but01100  Metabolic pathways
but01120  Microbial metabolism in diverse environments
but01200  Carbon metabolism
but01212  Fatty acid metabolism
Module
but_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    X994_1198
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    X994_1198
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:but01004]
    X994_1198
Enzymes [BR:but01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     X994_1198
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     X994_1198
Lipid biosynthesis proteins [BR:but01004]
 Fatty acid synthase
  Component type
   X994_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: AIV76957
Structure
PDB: 

Position
1:1405399..1406592
Genome map
AA seq 397 aa AA seqDB search
MIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVLVIGASTGYGLAARIA
AAFGAGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQATSINGDAFSDEIKHK
TIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHAVRLRGIDTDNEAIKETL
LQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVTHDIYWNGSI
GEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGT
HEGCIEQVDGLLRDSLYGAQPHVDAEGRLRADRLELDPAVQARVLELWDQVTDDNLYTLT
DFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtacgcggcttcatctgcgtcaccacccaccccgccggctgc
gcggcgagcgttcgcgagcagatcgcgtacgtcgcccgccgcggcccgatcgagcgcggc
ccgaagaaggtgctcgtgatcggcgcgtcgacgggctacgggctcgccgcgcgcatcgcc
gccgcgttcggcgcgggcgcggcgacgctcggggtgttcttcgagcgcgcgccggcggac
gcgaagcccggcacggccggctggtacaacagcgcggcgttccacgacgaagcggccgcg
cgcggcctccaggcgacgagcatcaacggcgacgcgttctccgacgagatcaagcacaag
acgatcgatgcgatccggcgcgatctcgggcaggtggaccttgtcgtctacagcgtcgcc
gcgccgcgcaggacgcatccgaaaacgggcgtcacgcatcagtcgacgttgaagccgatc
ggccacgcggtgcggctgcgcggcatcgatacggacaacgaggcgatcaaggaaacgctg
ctgcagccggccacgcccgacgagatcgcggacacggtcgccgtgatgggcggcgaggac
tggcgcatgtggatcgacgcgctcgatgcggcgggagtgcttgccgacggcgcgaagacg
accgcgttcacgtatctgggcgagcaggtcacgcacgacatctactggaacggctcgatc
ggcgaagcgaagaaggatctcgaccgcaccgtgctcgcgctgcgcggcaagctcgccgcg
cgcggcggcgacgcgcgcgtctcggtgctgaaggcggtcgtcacgcaggcgagctccgcg
atcccgatgatgccgctctacctgtcgctgctcttcaaggtgatgaaggcgcgcggcacg
catgaaggctgcatcgagcaggtcgacggcctgttgcgcgacagcctgtacggcgcgcag
ccgcacgtcgacgccgaaggccggctgcgcgcggaccgcctcgagctcgatccggccgtg
caggcgcgcgtgctcgagctgtgggaccaggtgacggacgacaatctgtatacgctcacc
gatttcgccggctacaaggccgaattcctgcgcctgttcggcttcgggatcgacggcgtc
gattacgatgcgcctgtcgagccgaacgtacggattccgaatctgatcgaataa

DBGET integrated database retrieval system