KEGG   Burkholderia pseudomallei TSV202: X994_2845Help
Entry
X994_2845         CDS       T03428                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00670  One carbon pool by folate
but01100  Metabolic pathways
but01120  Microbial metabolism in diverse environments
but01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    X994_2845 (metF)
Enzymes [BR:but01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     X994_2845 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AIV77176
UniProt: A0A069B5T4
Position
1:3289248..3290078
Genome map
AA seq 276 aa AA seqDB search
MNPIELSFEFFPPKTAEGVDKLRATRAQLAPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
AGLEAAPHLSCIGSSKDSLRAILDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFRIEVAAYPEYHPQARSPKADLENFARKVKAGANAAITQYFYNADAYFRFVD
DAAKLGVDVPVVPGIMPITNFSQLMRFSEMCGAEVPRWVARRLESFGDDKDSIRAFGADV
VTGLCRRLIDAGVPGLHFYTLNGAAATKTVCERLGL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgatcgaactttcctttgaattctttccgccgaagacggcggaaggcgtcgac
aagctgcgcgcgacgcgcgcgcagctcgcgccgctcaagccgaaattcgtgtccgtcacg
ttcggcgcgggcggctcgacgcagcaaggcacgctcgacaccgtgctcgacatgcagaag
gcggggctcgaagccgcgcctcacctgtcgtgcatcggctcgtcgaaggacagcctgcgc
gcgattctcgaccagtatcgctcgcacggcatccgccacatcgtcgcgttgcgcggcgat
ctgccttccggcatgggcgaggtgggcgagctgcgctacgcgtcggagctcgtcagcttc
atccgcgccgagcatggcgactggttccggatcgaagtggccgcgtatcccgagtaccac
ccgcaggcgcgctcgccgaaggccgatctcgagaacttcgcgcgcaaggtgaaggcgggc
gcgaacgccgcgatcacgcagtatttctacaacgcggacgcgtatttccgcttcgtcgac
gatgcggcgaagctcggcgtcgacgtgccggtcgtgccgggcatcatgccgatcacgaac
ttctcgcaactgatgcgcttctcggagatgtgcggcgcggaagtgccgcgctgggtcgcg
cgccggctcgagagcttcggcgacgacaaggattcgatccgcgcgttcggcgcggacgtc
gtcacgggcctttgccggcggctcatcgacgcgggcgtgcccggtctgcacttctacacg
ctcaacggcgcggcggcgacgaagacggtctgcgagcggctggggctctga

DBGET integrated database retrieval system