KEGG   Burkholderia pseudomallei TSV202: X994_2925Help
Entry
X994_2925         CDS       T03428                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but03010  Ribosome
Brite
KEGG Orthology (KO) [BR:but00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    X994_2925 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:but03011]
    X994_2925 (rplV)
Ribosome [BR:but03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    X994_2925 (rplV)
  Bacteria
    X994_2925 (rplV)
  Archaea
    X994_2925 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AIV78030
UniProt: A0A069BC48
Position
1:3373552..3373881
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaagacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggctggcatcgtgaagaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgacatcgacgagctcaagatcaagagcatctacgtcgacaaggctgca
tcgctcaagcgtttcaccgcgcgcgcaaagggccgcggcaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system