KEGG   Burkholderia pseudomallei TSV202: X994_3096Help
Entry
X994_3096         CDS       T03428                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
but  Burkholderia pseudomallei TSV202
Brite
KEGG Orthology (KO) [BR:but00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    X994_3096 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AIV78327
UniProt: A0A069B4M6
Position
1:3543585..3543959
Genome map
AA seq 124 aa AA seqDB search
MSQYRFSVSVKTSYLPEQSDPEHRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESQVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatcgattcagcgtgtcggtgaagaccagctatttgccggaacaatccgac
cccgaacaccgtcaatacgcattcgcgtacacgctgacgatccgcaatacggggcaggtg
gccgcgcagttgatcgcccggcactggatcatcacggacagcgagagccaggttcaggag
gtgaaggggctcggcgtcgtcggccatcagccgttgctgcagccgggcgagcagttcgag
tacacgagctgggcggtgatcgcgacgccggtgggcacgatgcgcggcgcgtatttttgc
gtcgcggaggacggcgagcgcttcgaggcgcccgtcgacgaattcgcgctgcacatgccg
cgcacgctgcactga

DBGET integrated database retrieval system