KEGG   Burkholderia pseudomallei TSV202: X994_4106Help
Entry
X994_4106         CDS       T03428                                 

Definition
(GenBank) succinate CoA transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00020  Citrate cycle (TCA cycle)
but00620  Pyruvate metabolism
but00650  Butanoate metabolism
but01100  Metabolic pathways
but01110  Biosynthesis of secondary metabolites
but01120  Microbial metabolism in diverse environments
but01130  Biosynthesis of antibiotics
but01200  Carbon metabolism
Module
but_M00009  Citrate cycle (TCA cycle, Krebs cycle)
but_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X994_4106
   00620 Pyruvate metabolism
    X994_4106
   00650 Butanoate metabolism
    X994_4106
Enzymes [BR:but01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     X994_4106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AIV75552
UniProt: A0A095QQE0
Position
2:complement(476197..477711)
Genome map
AA seq 504 aa AA seqDB search
MPTSRILAPSLRSLVRTADEAAALIGPNMTVAMSGFTGSGYPKAVPAALAARIAASHARG
EDFRINVLTGASTAPELDGALAKADGISMRLPYQSDPTLREKINAGELDYQDIHLSHVAQ
YAWFGLFGELDVAIVEVAGIREDGRLIPSASVGNNKTWLDQAKRVILEVNARQPLGLDGM
HDIYYGTALPPNRKPIPLVKSDDRIGEPYLRCPAEKIVAIVETDAPDRSNAFAAPDETSK
QIAGLLIDFLRHEIKRGRLPEHLLPLQSGVGNITNAVLAGLGEGGFSNLSAYTEVIQDGM
LDLLANGTLSFASATALSLSPDAVKRFADEIDTFRSKIVLRPQEISNHPELVRRLGIIAM
NGMIEADIYGNVNSTHVMGTRIQNGIGGSGDFARNGYLSCFMSASTAKGGAISRIVPMAS
HVDHTEHDVAVVVTEQGLADLRGLSPKQRARKVIANCAHPDYRPMLEDYFERASRESFGK
QTPHLLGEALSWHERYVRTGSMKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccaacctctcgtatcctcgcccccagcctgcgctccctcgttcgcaccgccgacgag
gccgccgcgctgatcggcccgaacatgaccgtcgcgatgagcggcttcaccggctccggc
tatccgaaggcggtgccggccgcgctcgccgcgcggatcgcggcttcccacgcgcgcggc
gaagatttccgcatcaacgtgctgacgggcgcgtcgaccgcgcccgagctggacggcgcg
ctcgcgaaggcggacggtatctcgatgcggctgccgtaccagtccgatccgacgctgcgc
gagaagatcaacgcgggcgagctcgactatcaggacatccacctgagccacgtcgcgcag
tacgcgtggttcggcctgttcggcgagctggacgtcgcgatcgtcgaggtcgcgggcatt
cgcgaggacgggcgcctgattccgtcggcgtcggtcggcaacaacaagacgtggctcgac
caggccaagcgcgtgatcctcgaggtgaacgcgcgccagccgctcggtctcgacgggatg
cacgacatctattacggcaccgcgctgccgccgaaccgcaagccgattccgctcgtgaag
agcgacgaccggatcggcgagccgtatctgcgctgcccggccgagaagatcgtcgcgatc
gtcgagaccgacgcgccggaccgcagcaacgcgttcgccgcgccggacgagacctccaag
cagatcgccggactcctgatcgatttcctgcgtcacgagatcaagcgcggccgtctgccc
gaacacctgctgccgctgcagtccggcgtcggcaacatcacgaacgcggtgctcgccggc
ctcggcgaaggcggtttctcgaacctgagcgcgtatacggaagtgattcaggacggcatg
ctcgatctgctcgcgaacggtacgctgagcttcgcgtcggcgaccgcgctgtcgctcagc
ccggatgcggtgaagcgcttcgccgacgagatcgatacgttccgctcgaagatcgtgctg
cggccgcaggaaatcagcaaccatccggagctcgtgcggcgcctgggcatcatcgcgatg
aacgggatgatcgaggccgatatctacggcaacgtgaactcgacgcacgtgatgggcacg
aggattcagaacgggatcggcggctccggcgatttcgcgcgcaacggctatctgtcgtgc
ttcatgtcggcgagcaccgccaagggcggcgcgatttcgcggatcgtgccgatggcaagc
cacgttgaccataccgagcacgacgtcgcggtcgtcgtgaccgagcaggggctcgcggat
ctgcgtggactgtcgccgaagcagcgcgcgcgcaaggtcatcgcgaactgcgcgcatccc
gattaccggccgatgctcgaagactacttcgagcgcgcgagccgcgagagcttcggcaag
cagacgccgcatctgctcggcgaagcgctgtcgtggcacgagcgctacgtgcggaccgga
tcgatgaaagcctga

DBGET integrated database retrieval system