KEGG   Burkholderia pseudomallei TSV202: X994_5813Help
Entry
X994_5813         CDS       T03428                                 

Definition
(GenBank) phosphoesterase family protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00562  Inositol phosphate metabolism
but00564  Glycerophospholipid metabolism
but01100  Metabolic pathways
but01110  Biosynthesis of secondary metabolites
but02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    X994_5813
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    X994_5813
   00565 Ether lipid metabolism
    X994_5813
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    X994_5813
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:but02042]
    X994_5813
Enzymes [BR:but01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     X994_5813
Bacterial toxins [BR:but02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   X994_5813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AIV75388
Position
2:complement(2611842..2613224)
Genome map
AA seq 460 aa AA seqDB search
MAKILENVEHIVVVMFENRSFDTMLGWLYSPDAPPAHVLPPQSSPQFDGLRPEMSNPSKA
GKTIAVTREALNSVIPDPQETFVNVTSQILGPSDAGTPWPPMQGFVVNYETTQTTDPGHV
MQCHSVAQLPTLTALARAYAVSDAWFASVPSQTWPNRAFAHAGTSNGHVNNGAIPDPLEW
DVPTIFDVLSSIGASWAVYSDTTVTPSLTHTMFPSLWKDAYAERFRHFPDFVAACGNDAL
PQYAFIEPSFLFEPNDQHPPHDVRAGDKFLHDIWTAIRTSPGWPRTLLVVTYDEHGGCFD
HVLPPANATPPDNASNPGDEAFGFYRFGVRVPAVVVSPYIEAGTVFRSPTNVPYDHTSIL
ATLRDWLDIPPDRMLGSARIANAPTLAQLVTRDTPRTDLPTIAAPSTDFVHPPPDAPLND
VQKSLVTGTSRRDGHDPAAGVAPIATRQHALDFFKRRAAA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagatcctcgaaaacgtcgagcacatcgtcgtcgtgatgttcgagaaccgctcg
ttcgacacgatgctcggctggctctattcgcccgacgcgccgcccgcgcacgtgctgccg
ccgcagagctcgccgcaattcgacggcctgaggcccgagatgtcgaatccgtcgaaggcg
ggcaagaccatcgccgtcacgcgcgaggcgctcaacagcgtgatccccgatccgcaggag
acattcgtcaacgtgacgagccagatcctcggcccgagcgatgcaggcaccccgtggccg
ccgatgcagggcttcgtcgtcaattacgaaacgacgcagacgaccgatccgggccacgtg
atgcaatgccacagcgtcgcgcaactgccgacgctcacggcgctcgcgcgcgcgtacgcg
gtgtccgacgcgtggttcgcgtcggtgccgagccagacctggccgaaccgcgcgttcgcg
cacgccggcacgtcgaacgggcacgtgaacaacggcgcgatccccgatccgctcgaatgg
gacgtgccgacgatcttcgacgtgctgtcgtcgatcggcgcgagctgggcggtgtacagc
gacacgaccgtcacgccgtcgctcacgcacacgatgttcccgtcgctgtggaaggatgca
tacgccgagcgcttcaggcacttcccggatttcgtcgccgcgtgcggaaacgacgcgctg
ccgcaatacgcgttcatcgagccgagcttcctgttcgagccgaacgaccagcatccgccg
cacgacgtgcgcgcgggcgacaagttcctgcacgacatctggacggcgatccgcacgtcg
cccggctggccgcgcacgctgctcgtcgtgacctatgacgagcacggcggctgcttcgac
cacgtgctgccgcccgcgaacgcgaccccgccggacaacgcgagcaaccccggcgatgag
gcgttcggcttctatcgcttcggcgtgcgggtgccggccgtcgtcgtgtcgccgtacatc
gaggcgggcaccgtgttccgctcgccgacgaacgtcccgtacgatcacacgtcgatcctc
gcgacgctgcgcgactggctcgatattccgcccgaccggatgctcggcagcgcgcggatc
gcgaacgcgccgacgctcgcgcaactcgtcacacgcgacacgccgcgcaccgatctgccg
acgatcgccgcgccgtcgaccgacttcgtccatccgccgccggatgcgccgctcaacgac
gtgcaaaagagcctcgtgacgggcacgtcgcggcgcgacgggcacgatccggccgccggc
gtcgcaccgatcgcgacgcgccagcacgcgctcgatttcttcaagcgccgggcggcggct
tag

DBGET integrated database retrieval system