KEGG   Burkholderia pseudomallei TSV202: X994_6138Help
Entry
X994_6138         CDS       T03428                                 

Definition
(GenBank) amino ABC transporter, permease , 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10016  histidine transport system permease protein
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:but00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    X994_6138
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:but02000]
    X994_6138
Transporters [BR:but02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    X994_6138
   Histidine transporter
    X994_6138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIV76026
UniProt: A0A069B8G8
Position
2:complement(3095461..3096150)
Genome map
AA seq 229 aa AA seqDB search
MLFQGFGPLLWAGTIETVKLAVLSLAASLVLGLAGAAAKLSSNRALASVGTFYTTLIRAV
PDLVLMLLLFYGIQILLNDVTDMLGAEQIDIDPFVAGIVTLGFIYGAYFTETFRGAFLAV
PRGQLEAGFAYGMGAWRVFARIMFAQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTLNFFFFTLAAGAIYLAITTLSNLVLMYLEKRYSAGVRRVAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctctttcaaggcttcggcccgctgctctgggccggcacgatcgagacggtcaagctc
gccgtgctttcgctcgccgcgtcgctcgtgctcgggcttgccggcgcggccgccaagctg
tcgtccaatcgcgcgttggcgagcgtcggcacgttctacacgacgctgattcgcgcggtg
ccggacctcgtgctgatgctgctgctgttctacggcatccagatcctgctgaacgacgtg
accgacatgctcggcgccgagcagatcgacatcgatccgttcgtcgccggcatcgtcacg
ctgggcttcatctacggcgcctacttcaccgagacgtttcgcggcgcgttcctcgcggtg
ccgcgcggccagctcgaagcgggcttcgcgtacggcatgggtgcgtggcgcgtgttcgcg
cggatcatgtttgcgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaggcgaccgcgctcgtgtcgatcatcgggctggccgacgtcgtgaaggcc
gcgcaggacgccggcaagagcacgctgaatttcttcttcttcacgctcgcggcgggcgcg
atctacctcgcgatcacgacgctgtcgaacctcgtgttgatgtacctcgaaaaacgctat
tcggcgggtgtgcggagggtggcgctgtga

DBGET integrated database retrieval system