KEGG   Burkholderia pseudomallei TSV202: X994_674Help
Entry
X994_674          CDS       T03428                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00071  Fatty acid degradation
but00072  Synthesis and degradation of ketone bodies
but00280  Valine, leucine and isoleucine degradation
but00310  Lysine degradation
but00362  Benzoate degradation
but00380  Tryptophan metabolism
but00620  Pyruvate metabolism
but00630  Glyoxylate and dicarboxylate metabolism
but00640  Propanoate metabolism
but00650  Butanoate metabolism
but00900  Terpenoid backbone biosynthesis
but01100  Metabolic pathways
but01110  Biosynthesis of secondary metabolites
but01120  Microbial metabolism in diverse environments
but01130  Biosynthesis of antibiotics
but01200  Carbon metabolism
but01212  Fatty acid metabolism
but02020  Two-component system
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X994_674
   00630 Glyoxylate and dicarboxylate metabolism
    X994_674
   00640 Propanoate metabolism
    X994_674
   00650 Butanoate metabolism
    X994_674
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X994_674
   00072 Synthesis and degradation of ketone bodies
    X994_674
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X994_674
   00310 Lysine degradation
    X994_674
   00380 Tryptophan metabolism
    X994_674
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X994_674
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X994_674
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X994_674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:but04147]
    X994_674
Enzymes [BR:but01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X994_674
Exosome [BR:but04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X994_674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIV80094
UniProt: A0A095HM55
Position
1:758468..759652
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREVLSRAQVSGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGIAQHAPALTVNRLCGSGLQAIVSAAQNVLLGDADIAVAGGAENM
SRAPYSVPAARFGQRMGDAKLVDMMIGALNDPFQSIHMGVTAENVAAKYGITRDAQDALA
LESHRRASHATKSGYFKDQILPIEIASRKGTVVFDADEHVRHDASLDDFTKLKPVFAKEN
GTVTAGNASGINDAAAAVVLMERGVADKRGAKPLARLVSYAHAGVDPAYMGIGPVPATKK
ALERAGITVADLDVIEANEAFAAQACAVSNALGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtagtggtggtgagcggcgtacgcacggcgatcggcgatttcggcggc
agcctgaaggacttcgcgccgaccgagctcggcgcgcgggtcgtgcgcgaggtgctgtcg
cgcgcgcaggtgtcgggcgacgaggtcggccacgtcgtgttcggcaatgtcgtgcacacg
gagccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggcggcatcgcgcagcac
gcgcccgcgctgacggtcaaccgtctctgcggctccggcctgcaggcgatcgtgtcggcc
gcgcagaacgtgctgctcggcgacgcggacatcgcggtcgcgggcggcgcggagaacatg
agccgcgcgccgtactcggtgccggccgcgcgcttcggccagcgcatgggcgatgcgaag
ctcgtcgacatgatgatcggcgcgctcaacgatccgttccagtcgattcacatgggcgtg
acggccgagaacgtcgcggcgaagtacgggatcacgcgcgacgcgcaggacgcgctcgcg
ctcgaatcccaccggcgcgcgtcgcatgcgacgaaatccggctatttcaaggatcagatc
ctgccgatcgagatcgcgtcgcgcaagggcacggtcgtgttcgacgccgacgagcacgtg
cgccacgacgcgtcgctcgacgacttcacgaagctcaagcccgtgttcgccaaggagaac
ggcacggtgacggcgggcaacgcgtcgggcatcaacgatgcggccgccgcggtggtgctg
atggagcgcggcgtcgccgacaagcgcggcgcgaagccgctcgcgcgcctcgtctcgtat
gcgcacgcgggcgtcgatccggcatacatgggcatcggccccgtgcccgcgacgaagaag
gcgctcgagcgcgcgggcatcaccgtcgccgatctcgacgtgatcgaggcgaacgaggcg
ttcgccgcgcaggcgtgcgcggtgtcgaacgcgctcggtctcgatccggcgaaggtcaac
ccgaacggctcgggcatctcgctcggccatccgatcggcgcgacgggcgcgctcatcacc
gtgaaggcgctgtacgagctgcagcggatcggcgggcgctacgcgctcgtcacgatgtgc
atcggcggcgggcagggcattgccgcggtgttcgagcgtctgtga

DBGET integrated database retrieval system