KEGG   Burkholderia sp. BDU6: WS70_04930Help
Entry
WS70_04930        CDS       T06044                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
buu  Burkholderia sp. BDU6
Pathway
buu00450  Selenocompound metabolism
buu00970  Aminoacyl-tRNA biosynthesis
buu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    WS70_04930
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WS70_04930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:buu01007]
    WS70_04930
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:buu03016]
    WS70_04930
Enzymes [BR:buu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     WS70_04930
Amino acid related enzymes [BR:buu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   WS70_04930
Transfer RNA biogenesis [BR:buu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    WS70_04930
 Prokaryotic type
   Other AARSs
    WS70_04930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AOJ01253
UniProt: A0A1B4FC58
Position
1:complement(1081517..1083676)
Genome map
AA seq 719 aa AA seqDB search
MSASDLTSVQAGAPQGRRQILVTSALPYANGQIHIGHLVEYIQTDVWVRTMRMHGHEIYY
IGADDTHGTPVMLRAEQESVTPKQLIERVWREHKRDFDSFGVSFDNFYTTDSDENRVLSE
KIYLALKNAGFIAEREIEQAYDPVKEMFLPDRFIKGECPKCHAKDQYGDSCEVCGTTYQP
TDLVNPYSVVSGATPVRKTSTHYFFRLSDPRCEAFLREWVSGLAQPEATNKMREWLGDAG
EAKLADWDISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLCEQRGIDFDAWIKKD
STTEQYHFIGKDILYFHTLFWPAMLEFSDHRTPTNVFAHGFLTVDGAKMSKSRGTFITAQ
SYIDTGLNPEWLRYYFAAKLNATMEDIDLNLEDFQARVNSDLVGKYVNIASRAAGFLIKR
FDGRVQDSAMNHPLLAALRDAIPQIAAHYEAREYGRALRQTMELADEVNGYVDTAKPWEL
AKDPANAAALHETCSVSLEAFRLLSLALKPVLPRVSEGVEAFFGVAPLAWADANKPLSSE
QPIRAYQHLMTRVDPKQLDALLAANRGSLQGAAAAAADAGAAGGNGAKNAKRVKDAKAAP
ATDDAVPIIAIDDFAKIDLRIAKIVACEAVDGSDKLLRLTLDVGEKKTRNVFSGIKSAYQ
PEDLVGKLTVMVANLAPRKMKFGVSEGMVLAASAADEKAEPGLYILEPHSGAKPGMRVK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatccgacctcacctccgtgcaggccggcgcgccgcaaggccgccgccagatc
ctcgtcacgtccgcgctgccctatgcgaacgggcagattcacatcggccacctggtcgag
tacatccagaccgacgtctgggtgcggacgatgcgaatgcacggccacgagatctactac
atcggcgcggacgacacgcacggcacgcccgtcatgctgcgcgccgagcaggaaagcgtg
acgccgaagcagttgatcgagcgcgtgtggcgagaacacaagcgcgacttcgacagcttc
ggggtctcgttcgacaacttctatacgacggactccgacgaaaaccgcgtgctgagcgag
aagatttacctcgcgctgaagaacgccggcttcatcgccgagcgcgagatcgagcaggct
tacgatcccgtcaaggaaatgttcctgccggaccgcttcatcaagggcgagtgcccgaaa
tgccacgcgaaagaccagtacggcgacagttgcgaagtgtgcggcacgacgtaccagccg
acggatctcgtcaatccgtactcggtcgtgtcgggcgcgacgcccgtgcgcaagacgtcg
acgcactacttcttccggctgtccgacccgcgctgcgaggcattcctgcgcgaatgggtg
agcggcctcgcgcagcccgaagcgaccaacaagatgcgcgaatggctcggcgacgcgggc
gaggcgaagctcgccgattgggacatctcgcgcgacgcgccctacttcggcttcgagatc
cccggcgcgcccggcaagtatttctacgtgtggctcgatgcgcccgtcggctactacgcg
agcttcaagaacctgtgcgagcagcgcggcatcgatttcgacgcgtggatcaagaaggac
tcgacgaccgagcagtatcacttcatcggcaaggacatcctgtacttccacacgctgttc
tggcccgcgatgctcgagttctcggaccatcgcacgccgaccaacgtattcgcgcacggc
tttctgacggtcgacggcgcgaagatgtcgaagtcgcgcggcaccttcatcaccgcgcag
agctacatcgacacgggcctcaaccctgaatggctgcgctactacttcgccgcgaagctc
aacgcgacgatggaagacatcgacctgaacctcgaggacttccaggcgcgcgtgaacagc
gacctcgtcggcaagtacgtgaacatcgcgagccgcgcggcgggtttcctgatcaagcgc
ttcgacggccgcgtgcaggacagcgcaatgaaccatccgctcctcgcggcgctgcgcgat
gcgatcccgcagatcgccgcgcactacgaagcgcgcgagtacggccgcgcgctgcgccag
acgatggagctcgccgacgaggtcaacggctacgtcgacacggcgaagccgtgggagctc
gcgaaggacccggcgaacgcggccgcgctgcacgaaacctgcagcgtgagcctcgaggca
ttccgcctgctgtcgctcgcgctgaagcccgtgctgccgcgcgtctcggagggcgtcgaa
gcgttcttcggcgtcgcgccgctcgcgtgggccgacgcgaacaagccgctgtcgtccgag
cagccgatccgcgcgtatcagcacctgatgacccgcgtcgatccgaagcagctcgacgcg
ctcctcgccgcgaaccgcggctcgcttcagggcgccgccgcggcggcagccgatgcgggc
gcggcgggcggcaacggcgcgaagaatgcgaagcgcgtgaaggatgcgaaagccgcgccc
gccaccgacgacgcagtgccgatcatcgcgatcgacgacttcgcgaagatcgatctgcgc
atcgcgaagatcgtcgcgtgcgaagccgtcgatggctccgacaagctgctgcggctcacg
ctcgacgtcggcgagaagaagacccgcaacgtgttctccgggatcaagtcggcgtaccag
ccggaggatctcgtcggcaagctgacggtgatggtcgcgaacctagcgccgcgcaagatg
aagttcggcgtgtccgaagggatggtgctcgccgcgtcggcagccgacgaaaaggccgag
ccgggcctctacatcctcgagccgcatagcggcgcgaagcccggcatgcgcgtgaagtaa

DBGET integrated database retrieval system