KEGG   Burkholderia sp. BDU6: WS70_22935Help
Entry
WS70_22935        CDS       T06044                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
buu  Burkholderia sp. BDU6
Pathway
buu00260  Glycine, serine and threonine metabolism
buu01100  Metabolic pathways
buu01110  Biosynthesis of secondary metabolites
buu01120  Microbial metabolism in diverse environments
buu01130  Biosynthesis of antibiotics
buu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WS70_22935
Enzymes [BR:buu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     WS70_22935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AOJ05766
UniProt: A0A1B4FQ10
Position
2:complement(1424408..1425478)
Genome map
AA seq 356 aa AA seqDB search
MIDFLSDTVTLPTAEMRHAMFTANVGDDCYGEDPTVNELESVAAGMTGKEAAAFVTSGTL
GNLTALLAQCPRGHEVILGDRSDLYNYEAGGVSLVGGAVLHPVATADDGSLPVERLRAAI
RDKTDYQCAPAAVIALENPHCLAGGRVLSLDYLRRVRTLADAHGLAVHMDGARLFNAQAS
LGVSAADIVAHVDSVQFCLSKSLAAPYGSMVCGSAGLIDRVKRYRKLLGGGTRQAGIMAA
AGLVALRTMVARLSDDHRRAARLADELSRIPGVALRSAAVETNMVFFDVAEPGNEAFLAA
LHGAGIRMGVLGDGVIRAVVHYMIDDDAINRTVDAARAILRPFAPASKPAAAPEAQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttcctgagcgacacggtgacgctgccgaccgccgagatgcggcacgcgatg
ttcacggcgaacgtgggcgacgactgttacggcgaggacccgacggtcaacgagctggag
tcggttgcggccggcatgaccggcaaggaggcggcggcgttcgtcacgagcggcacgctc
ggcaacctgaccgcgctgctcgcgcagtgcccgcgcgggcacgaagtgatcctcggcgac
cgctccgatctctacaactacgaggcgggcggcgtgtcgctcgtcggcggcgcggtgctg
catcccgtggcgacggcggacgacggcagcttgccggtcgagcggctgcgcgcggcgatc
cgcgacaagaccgactaccagtgcgcgcccgccgcggtgatcgcgctcgagaatccgcat
tgcctcgccggcggccgcgtgctgtcgctcgactatctgcggcgggtgcgcacgctcgcc
gacgcgcacgggctcgccgtgcacatggacggcgcgcgcctcttcaacgcgcaagcgagc
ctcggcgtgagcgcggccgacatcgtcgcgcacgtcgattcggtccagttctgcctgtcg
aagagcctcgccgcgccgtacggctcgatggtgtgcggcagcgccggcctgatcgatcgc
gtgaagcgctatcggaagctgctcggcggcggcacgcggcaggccggcatcatggcggcc
gccgggctcgtcgcgctgcgcacgatggtcgcgcggctgtccgacgatcaccgccgcgcg
gcgcgcctcgcggatgagttgtcgcggatcccgggcgtcgcgctgcgctcggcggcggtc
gagacgaacatggtgttcttcgatgtcgccgagccgggcaacgaagcttttctcgccgcg
ctgcacggcgcaggcatccggatgggcgtgctcggcgacggggtcatccgggccgtcgtg
cactacatgatcgacgacgacgcgatcaaccgcaccgtcgacgcggcgcgggcgattctc
cgtccgttcgcaccggcgtccaagccggccgccgcgccggaggcgcaatga

DBGET integrated database retrieval system