KEGG   Burkholderia sp. BDU6: WS70_26240Help
Entry
WS70_26240        CDS       T06044                                 

Definition
(GenBank) geranyl transferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
buu  Burkholderia sp. BDU6
Pathway
buu00900  Terpenoid backbone biosynthesis
buu01100  Metabolic pathways
buu01110  Biosynthesis of secondary metabolites
buu01130  Biosynthesis of antibiotics
Module
buu_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:buu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WS70_26240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:buu01006]
    WS70_26240
Enzymes [BR:buu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     WS70_26240
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     WS70_26240
Prenyltransferases [BR:buu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   WS70_26240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt HBS1_N
Motif
Other DBs
NCBI-ProteinID: AOJ05210
UniProt: A0A1B4FNE2
Position
2:complement(2159540..2160424)
Genome map
AA seq 294 aa AA seqDB search
MTFDQWMRSVLERVETALGHYLPAETVAPAQLHEAMRYAALGGGKRVRPLLCHAAGELTG
ASEAALNAAAAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVEYDEPTALLVGDALQSQ
AFVALTDAAALPLDRQAALVRELALASGSIGMAGGQAIDLASVGHALSRDALETMHRMKT
GALLRASVRMGALAGETPSEDAMRALDAYAAAVGLAFQVVDDILDVTTDSATLGKTAGKD
AANDKPTYVSIIGLDASRALAAQLRTDAYAALEPFGARARRLAELADLVVNRVS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgaccaatggatgcgctcggtgctcgagcgtgtcgagacggccctcggccat
tatttgccggccgaaactgtagcgcccgcacaactgcacgaagcgatgcgctatgcggcg
ctcgggggggggaaacgggtgcgtccgctgctgtgccatgcggcgggcgagctcactggc
gcgtcggaagcggcgctgaacgctgcagcggcggcgctcgaaatgattcacgtgtattcg
ctcgtgcatgatgatatgccgtgcatggacgacgacgcgctgcgtcgcggcaagccgacc
gtccatgtcgagtatgacgagcccaccgcgcttctcgtcggcgacgcgctgcagtcgcag
gccttcgtcgcgctgacggacgccgccgcgctgccgctcgaccggcaggccgcgctcgtg
cgcgagctcgcgctcgcgagcggctcgatcggcatggcgggcggtcaggcgattgatctc
gcgagcgtcggtcatgcgctttcgcgcgacgcgctcgagacgatgcaccggatgaagacg
ggcgcgctcctgcgtgcgtcggtgcggatgggcgcgctcgcgggcgagacgccgtccgaa
gacgcgatgcgcgcgctcgacgcatacgcggccgctgtcggcctcgcgttccaggtggtg
gacgacattctcgacgtcaccaccgattccgcgacgctcggcaagacggccggcaaggac
gcggcgaacgacaagccgacctacgtgtcgatcatcggcctcgacgcgtcgcgcgcgctt
gccgcgcaactgcgcaccgacgcgtacgccgcgctcgaaccgttcggcgcgcgcgcacgg
cgcctggctgaactggcggacctggtggtgaaccgggtcagctga

DBGET integrated database retrieval system