KEGG   Butyricimonas sp. H184: D8S85_11140Help
Entry
D8S85_11140       CDS       T05785                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K18119  succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
buy  Butyricimonas sp. H184
Pathway
buy00650  Butanoate metabolism
buy01100  Metabolic pathways
buy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:buy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D8S85_11140
Enzymes [BR:buy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     D8S85_11140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AZS30045
UniProt: A0A3S9VU00
Position
2537804..2539159
Genome map
AA seq 451 aa AA seqDB search
MEIKEMIERARKAQVIYDERFDQEGVDQVIKAAARTIFDHAEELARLTIDETQMGVYEDK
VAKNRNKSKGVWYNLKGKKSMGILSIDERTNLIEIAKPIGVVAGITPMTNPVVTPMSKII
FALKTKNAIIIAPHPKAKQCSSAAVKLIIEAIAPFEVPEGLVQVIEEPTIEKTCELMEAC
DVVVATGGMPMVKSAYSSGKPSFGVGAGNVQVILDRFIDFDTAAEKVITGRSFDNGIICS
GEQSFIYHKDDRQEVMDAFRRHGAYIVPEEDRDKVVNALFEDGHICRDIVGQSVQTIASK
ADIFVPGNTRVLVVEAHGIGRDDLICKEKMCPVMAAFSYDNFDEAIKIAKTNLFMEGNGH
TAGIHSNNQANIIKAGTELSVSRLIVNAPCATTAGGSIQNGLPVTNTLGCGSWGNNSISE
NFTYKHLLNITRIAPLSARIHVPSDAEIWDL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaagaaatgatagaaagagcccgcaaagctcaagtcatttatgacgaacga
ttcgaccaggaaggagtcgatcaagtcattaaagctgccgcccgcacgatttttgaccat
gcagaagaactggcacgccttacgattgacgagacccaaatgggtgtctacgaagacaaa
gttgccaaaaacaggaataaatccaagggggtatggtataacctgaaagggaaaaaatcc
atggggatcctaagtattgacgagagaactaatcttatcgaaatcgccaaacctattggt
gtggttgccggtattaccccgatgacaaaccccgtggttaccccgatgtctaaaatcatt
tttgcattaaaaacgaagaacgccatcatcatagctcctcacccgaaagcaaaacaatgc
tccagtgcagctgttaaactcattatcgaggccatcgccccgtttgaagttccggagggt
ctggttcaggtgattgaagaacccacgatcgaaaagacctgcgagttgatggaagcttgt
gatgtcgtggtggccacgggtggaatgcccatggtgaaatcggcttactcttcgggcaaa
ccctcttttggtgtcggagcgggtaacgtacaggtaatcctggatcgatttattgatttc
gatacagcggcagaaaaagtcatcaccggccgttcttttgacaatggtattatctgttct
ggagaacaaagttttatttatcacaaagatgacagacaggaagtcatggacgcttttcgt
cgtcacggggcgtacatcgtgcctgaagaagatcgggacaaagtggttaatgcacttttt
gaagacgggcatatttgcagggacattgtcggacaatccgtccagacaatcgcaagcaaa
gccgacatcttcgtaccgggaaacacccgtgttctcgtggtagaagcgcacgggatagga
cgtgacgacctcatctgcaaagaaaaaatgtgtcctgtcatggctgctttttcttatgac
aattttgacgaagcgataaaaatcgccaagacaaatctattcatggaaggaaacggacac
acggccggcatccactccaacaaccaggcaaatattatcaaggccggaacggaactttcc
gtatcacgcctgatcgtgaatgccccgtgtgctaccacggcgggaggttccatacaaaac
ggtctccccgtgaccaacacgctcgggtgcggaagttggggaaataattctatttctgag
aatttcacctataaacacctattaaatatcacacgcatcgccccgttgtccgcacggata
cacgtaccttccgatgctgaaatatgggatttataa

DBGET integrated database retrieval system