KEGG   Butyricimonas sp. H184: D8S85_18010Help
Entry
D8S85_18010       CDS       T05785                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
buy  Butyricimonas sp. H184
Pathway
buy00030  Pentose phosphate pathway
buy00480  Glutathione metabolism
buy01100  Metabolic pathways
buy01110  Biosynthesis of secondary metabolites
buy01120  Microbial metabolism in diverse environments
buy01130  Biosynthesis of antibiotics
buy01200  Carbon metabolism
Module
buy_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
buy_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:buy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D8S85_18010 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D8S85_18010 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:buy04147]
    D8S85_18010 (zwf)
Enzymes [BR:buy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     D8S85_18010 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     D8S85_18010 (zwf)
Exosome [BR:buy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   D8S85_18010 (zwf)
  Exosomal proteins of colorectal cancer cells
   D8S85_18010 (zwf)
  Exosomal proteins of bladder cancer cells
   D8S85_18010 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AZS31262
UniProt: A0A3S9VXK4
Position
4187290..4188792
Genome map
AA seq 500 aa AA seqDB search
MNRPEDQVLVIFGASGDLTKRMLMPSLYELHVRQMLPERFVILGTSRKSMSDDEFRLSIR
LMLEELKGEKGLKGEEVDRFLQKVYYQPFDPVEGADELGERVMFLMEENAIPTRVVYYLA
TPPNSQQAITKYIGRSCLFGVKERGGWHRIVVEKPFGTSLETAKELDRALLQVFCEREIY
RIDHFLGKETVQNILVLRFANEIFESLWNRNYVDYVEIYALESLGIENRGKYYETTGALR
DMVQNHLMQLLAFVAMESPATMEPEVIRDETVKVLRSLRPWRGEDIPRNVVRAQYVAGES
KGQPVVGYLQEKDVAPNSDMETYVALKVFIDNWRWSHVPFYIYTGKRLKDKRSGVVIHFK
STPHKLFQGQCEGASCNQLIIRMTPDEGVMLKFGLKMPGGGFTVKQVGMDFLYASLCNNY
LPGAYERLLLDAMQGDSMLYTRDDALEASWKFIDPIVNYWREHPGEQLRTYAAGSEGPDL
SDVWDVVPPVLKEDKNVCWL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaccggaggatcaggtattagttatattcggggcatcgggcgatttgaccaaa
cggatgttgatgccctcgttgtacgagttgcacgtgcggcagatgttgccggagcgtttt
gttattttggggacttcgaggaaatccatgagtgacgacgagttccgtttgtcgatccgt
ttgatgttggaggagttgaaaggggaaaaaggcttgaagggggaagaggtggatcgtttc
ttgcagaaagtgtactaccagccttttgacccggtggagggagccgatgagttgggggaa
cgggtgatgtttttgatggaggaaaacgctatcccgacgcgggtggtgtattatctggca
actccgccgaattcccagcaggcaatcacgaaatacattgggagaagttgtctgtttgga
gtaaaggaacggggcggatggcaccggatcgtggtggaaaagcctttcgggacaagtttg
gagacggcgaaggagttggatagagccttgttgcaggtgttctgtgagcgggagatttat
cgcatcgatcattttttggggaaggagacggtacagaatatattggtcttgcgttttgca
aacgagatattcgaatccctgtggaaccggaattacgtggattacgtggagatatatgcc
ttggaatcgctcgggatcgagaaccggggaaagtattacgaaacgacgggggctttgcgg
gatatggtgcaaaaccatttgatgcagttgctggctttcgtggcgatggagtctccggcg
acgatggaaccggaggtgattcgcgacgagacggtgaaggtgttgcgctcgcttcgtccg
tggaggggggaggatattccccgcaatgttgtccgggcgcaatacgtggccggggaatca
aaggggcagcccgtggtcgggtatttgcaggaaaaggatgttgctccgaattccgacatg
gagacttacgtggcgttgaaagtgtttattgataactggcgttggagtcatgtgccgttt
tatatatacacgggcaagcgtttgaaggataagcgttccggggtggtgattcatttcaag
tcgacgccgcacaagttgtttcagggacaatgtgagggggcgtcctgtaaccagttgatt
attcgtatgacaccggatgagggggtgatgctgaagttcgggttgaaaatgccgggtggt
ggtttcacggtgaaacaggtggggatggatttcctgtatgcttccctgtgcaacaattat
ctgccgggggcttacgagcgtttgttactggatgccatgcagggggattcgatgctctac
acgcgggatgatgccttggaggccagttggaagtttatcgatccgatcgtaaattattgg
cgggaacacccgggagagcaattgcggacgtatgcggcgggaagcgaaggaccggacttg
agtgatgtgtgggatgtggttcctcctgttttaaaagaagataaaaatgtttgttggtta
tga

DBGET integrated database retrieval system