KEGG   Burkholderia sp. OLGA172: AYM40_03855Help
Entry
AYM40_03855       CDS       T05111                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00450  Selenocompound metabolism
buz00970  Aminoacyl-tRNA biosynthesis
buz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AYM40_03855
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AYM40_03855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:buz01007]
    AYM40_03855
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:buz03016]
    AYM40_03855
Enzymes [BR:buz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AYM40_03855
Amino acid related enzymes [BR:buz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AYM40_03855
Transfer RNA biogenesis [BR:buz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AYM40_03855
 Prokaryotic type
   Other AARSs
    AYM40_03855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Ribosomal_60s Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: ANB71601
UniProt: A0A160FHH6
Position
1:complement(897793..899928)
Genome map
AA seq 711 aa AA seqDB search
MSAPATDLSAGAPSGRRQVLVTSALPYANGQIHIGHLVEYIQTDIWVRTLRMHGHEVYYV
GADDTHGTPVMLRAEKEGLTPKQLIDRVWQEHKRDFDSFGISFDNYYSTDSEENRVLSES
VYLALKEAGLIEARDIEQAYDPVKEMFLPDRFIKGECPKCGAKDQYGDSCEVCGSTYLPT
ELVNPYSVVSGATPIRKTSTHYFFRLSDPRCENFLRAWVSGLAQPEATNKMREWLGDAGE
AKLADWDISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLAVKRGLDFDAWVRKGS
TAEQYHFIGKDILYFHTLFWPAMLEFSGHRTPTNVFAHGFLTVDGAKMSKSRGTFITAQS
VIDTGLNPEWLRYYFAAKLNSTMEDLDLNLDDFQARVNSDLVGKYVNIASRAAGFLIKRF
DGRVQDSAMQHPLLATLRAAVPQIAANYEAREYNRALRQTMELADAVNAYVDTAKPWDQA
KDPANEVALHETCSVSIEAFRLLSLALKPVLPKLAEAVEAFLGIEPLVWADANVPLSSTR
PINAYKHLMTRVDPKQIEALIAANRDSLQATPEAAAPADAKAKSKAAKAAAADKDEAPGV
ISIDDFARIDLRIAKIVDCKAVEGSDKLLQLTLDVGEEKTRNVFSGIKSAYQPEQLVGKL
TVMVANLAPRKMKFGMSEGMVLAASATDEKAEPGLYVLEPDSGAKPGMRVK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacccgcaaccgatctctccgcaggcgcgccgtcaggccgtcgccaggttctc
gtcacgtcggcccttccgtatgcgaatgggcaaatccatatcggccatctggtcgaatat
atccagacggacatctgggtccggacgttgcgaatgcacgggcatgaggtctactacgtg
ggcgccgacgacacgcacggcacgccggtcatgctgcgtgcggaaaaggaaggtctgacg
ccgaagcagctgatcgaccgcgtctggcaggagcacaagcgcgatttcgacagctttggg
atttcgttcgacaattactactcgaccgattccgaggaaaaccgcgtcctgagcgaatcg
gtctacctggcgctcaaggaagccggcctgatcgaagcgcgcgacatcgaacaggcctac
gaccccgtcaaggaaatgttcctgccggaccgcttcatcaagggcgaatgcccgaagtgc
ggcgcgaaggatcaatacggcgacagctgcgaggtatgcggttcgacttacctgccgacc
gaactggtcaatccgtattcggttgtctcgggcgcgacgccgattcgcaagacctcgacg
cactacttcttccgcctgtccgatccgcgctgcgagaatttcctgcgcgcgtgggtcagc
ggcctcgcgcagccggaagccaccaacaagatgcgcgaatggctcggcgacgctggcgaa
gccaagctcgccgactgggatatttcgcgcgacgcgccgtatttcggcttcgaaattccg
ggcgcgccgggcaaatatttctacgtgtggctggacgccccggtcggctattacgcgagc
ttcaagaacctggccgttaagcgcggcctcgacttcgacgcgtgggttcgcaagggctcg
accgccgagcagtaccacttcatcggcaaagacattctgtatttccacacgctgttctgg
ccggccatgctcgaattctcgggccaccgcacaccgaccaacgtgttcgcgcacggcttc
ctgacggtggacggcgcaaagatgtcaaagtcgcgcggcacgttcatcaccgcgcaaagc
gtgatcgacacgggcctgaatccggaatggctgcgctactacttcgccgccaagctgaac
agcacgatggaagacctcgacctgaacctcgacgacttccaggcgcgcgtgaacagcgat
ctggtcggcaagtacgtgaacatcgcgagccgcgccgccggcttcctgatcaagcgtttc
gacggccgcgtgcaggacagcgccatgcagcacccgttgctcgccacgctgcgcgccgcc
gtgccgcaaatcgccgcgaactatgaggcgcgcgagtacaaccgcgcgctgcgccagacc
atggaactggccgacgcggtcaatgcgtacgtcgacaccgccaagccgtgggatcaggcg
aaagacccggccaacgaggtcgcattgcacgaaacctgcagcgtgagtatcgaggcgttc
cgtctgctgtcgctggcgctcaagccggtgttgccgaagctggcggaagcggtggaagcc
ttcctcggcatcgagccgttggtgtgggccgacgcgaacgtgccgctctcctccacgcgc
ccgatcaacgcgtacaagcatctgatgacgcgcgtcgacccgaagcagatcgaggcgctc
atcgcagcgaatcgcgactcgctgcaagccacgccggaagctgcggcgccagcggatgcg
aaggccaagtcgaaagcagcgaaagcggccgctgccgataaagatgaagcgcccggcgtc
atctcgatcgacgacttcgccaggatcgatctgcgcattgcgaagattgtcgactgcaag
gcggtggaaggctcggacaagctgctgcaactcacgctcgacgtcggcgaagagaaaacg
cgcaacgtgttctcgggcatcaagtcggcctaccagccggagcaactggtcggcaagctg
acggtgatggtcgcgaacctcgccccgcgcaagatgaagttcggcatgtccgaagggatg
gtgctggcggcctccgcaactgacgagaaagccgaaccgggtctgtacgtgctcgagccg
gatagcggcgcgaagccgggcatgcgcgtgaagtaa

DBGET integrated database retrieval system