KEGG   Burkholderia sp. OLGA172: AYM40_07390Help
Entry
AYM40_07390       CDS       T05111                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00020  Citrate cycle (TCA cycle)
buz00620  Pyruvate metabolism
buz00650  Butanoate metabolism
buz01100  Metabolic pathways
buz01110  Biosynthesis of secondary metabolites
buz01120  Microbial metabolism in diverse environments
buz01130  Biosynthesis of antibiotics
buz01200  Carbon metabolism
Module
buz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AYM40_07390
   00620 Pyruvate metabolism
    AYM40_07390
   00650 Butanoate metabolism
    AYM40_07390
Enzymes [BR:buz01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     AYM40_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF
Motif
Other DBs
NCBI-ProteinID: ANB72208
UniProt: A0A160FJS9
Position
1:1716825..1718339
Genome map
AA seq 504 aa AA seqDB search
MMNTRVVAAGLRKRICSADDAAALIAPGMTVAMSGFTGAGYPKTVPPALASRIDDAHARG
LDFRINVLTGASTAPELDGALARANGITMRLPYQSDPTLRDKINDGEMDYLDIHLSHVAQ
NSWSGIFGEIDIALVEVCAIRDDGKLIPSSSVGNNKTWLERAKGVILEVNRRQPLELEGM
HDIYYGTALPPHRVPIPLLRSGDRIGERYLHCPADKILAIVETDASDRNNEFTPPDATSR
QIAGNLIEFLRHEVAMGRLPKTLLPLQSGVGNITNAVLSELGAVGFAGLTAYTEVIQDGM
LDMLQNGTLTVASATALSLSPSAFVRFAEHIGQFHERIVLRPQEISNHPELVRRLGCIAM
NGMMESDIYGNVNSTHVMGSRIQNGIGGSGDFARNGYLSCFMSASTAKNGSISCIVPMVS
HVDHTEHDVAVLVTERGLADLRGLSPKQRAQQIIARCADPAYQPMLQDYFDRACHQSFGK
HTPHLLKEALSWHERYIETGSMRS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atcatgaacacacgagttgtagccgccggtctacgcaaacgcatctgttccgccgatgat
gccgccgccttgattgctcctggcatgaccgttgcaatgagtggcttcactggcgcaggc
tatcctaagacagtgcctcctgcactagcctcgcggatcgatgacgcgcatgctcgcggt
ctggatttccgaattaatgtcctgaccggtgcatcgaccgctccagagctcgatggcgcc
ttggcgagagctaatggcatcacgatgcgccttccctatcagtcggatcctacgctgcga
gacaagatcaacgatggtgagatggattatctggacatccatctgagccatgtagcccag
aattcctggtctgggatttttggagaaattgatattgccttggtggaggtgtgcgcaata
cgcgatgacggcaagctgattccttcatcgtccgtcggcaacaacaagacgtggcttgaa
cgtgcgaagggcgtgatcctcgaagtgaatcggcgacagccgctggaacttgagggcatg
cacgacatctactatggaaccgcgttgccgccccaccgcgtaccgattccattgcttagg
agcggagatcgcatcggtgagcgctatcttcactgcccagccgacaagattctcgcgatc
gtcgaaaccgatgcttcggatcggaacaatgaattcacgccgcccgacgcgacgtcacgg
cagatcgccggaaatctcatagagttcttgcgtcacgaagttgcaatgggtcgcctgccc
aagacgctgctgccattgcagtcgggtgtgggaaacattacaaacgcagtgctctccgaa
ttgggggcggtcggatttgcggggctgaccgcctatacagaggtcattcaggatggaatg
ctagatatgctccaaaacggaacgttaactgtagcgtcggcgaccgcattatccttgagc
ccgtcagctttcgttcgctttgcggagcacattggtcaattccatgagcgcattgtattg
cggccccaggaaatcagtaaccaccctgaacttgtgcggcgactcggctgcatcgcgatg
aacggcatgatggaatcggacatctacggcaacgtaaattcgacgcatgtgatgggaagt
cgcatacagaatggaatcggtggctcaggcgatttcgcacgcaatggctacttgtcgtgc
ttcatgtctgccagcactgcaaagaacggaagtatctcgtgcatcgtgcctatggtaagc
cacgtcgatcatactgaacacgacgtcgcggttctggtgaccgaacgcggacttgccgac
ctgcgcggactctctccgaagcaacgcgctcagcaaatcatcgctcgatgcgcggatccc
gcatatcagccgatgttgcaagattatttcgatcgcgcctgccaccaaagcttcggcaaa
cacaccccacatcttttgaaagaagcattgtcgtggcacgaacgatacatcgagaccggt
tcgatgcgaagttaa

DBGET integrated database retrieval system