KEGG   Burkholderia sp. OLGA172: AYM40_07935Help
Entry
AYM40_07935       CDS       T05111                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:buz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AYM40_07935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:buz03400]
    AYM40_07935
Enzymes [BR:buz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AYM40_07935
DNA repair and recombination proteins [BR:buz03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AYM40_07935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ANB72297
UniProt: A0A161HNK8
Position
1:1846867..1850241
Genome map
AA seq 1124 aa AA seqDB search
MLQLFYSNRYETLVSALLDDLAQAPSDPWTARPVIVPSAAVRRRLELDIAVRQGICANVN
FGYLAQWLWAQIGGVIEVPRHSPFAPDRLVWRCYRLLGETDEALPWNASPRLRTYLDAAD
ASMRYELARRVATVLDHYLTYRPEWLLQWQKGGSIFASGAADDTGPRLVGASVAAREDER
WQAALWRAVLAEVAGNAQTPALALPPAYRFLEEIGTLDLEAISNAQWPEAVSVFALPTMP
PLHVALLRALSRWVDVRLYVMNPCREFWFDVVSAGRVEALDAAGQLDYQEVGHPLLAEWG
RQTQAQLHMLHELTESAASGETGDFTENPEPSWLAAVQNGILDLRAETDTDELPVENGIE
VHVCHSLSRQLEVLHDRLLGWFDEFGDLQPSDVLVAVSDLAAAGPLIDAVFGTAPLGDTR
RIPYRITGLPPSQANPVARLLLDWLALPERSVGAPDLIEWLRVDAIAARYGIDASALEAA
QEWLAAAGARRGLVPGEPTGEHVPVARHTFADALTRLYLGYAMPDGGEPVDAWLPVEGAD
GSAAELLGRLSRFVDDIETFAQRCAAEQTPAEWTQLLLETLAQCFDGGVEFADSLAAVRD
AIDKMGDAMQAGAEDVVLPAAVVRGALTEALDDPARGGVPWGSVTFSSLTSLRGLPYRIV
CLLGMDDGVLPSLARADEFDLMAAFGKAGDRQRRDDERNLFLDLLLAARDRLFIAYTGRS
IRDNAPLPPAALVDELLDHLAQVSAGEGASPAEIEAARHAFIVDHPLQAFASDYFSSQRG
LFTYDMDRAELASLLAAPQHPVAAPFFDQPLPAEDAAPVAFDEFVRFWRHPARALLRDRL
GIVLSDAQGELLDTEPFELDWAGRDALAERLLPVLLNSETEDEGLFDRVRRVAAASPELP
GGATGAVWRSRELGALRQLADSVRREVASGVERLPFVLDIVPRWPDRADIADTLFGPHDA
ALRKAAETPLQLHGTLNLLTETGQVIFRYAKPTARDYLSAWLAHLVYCAAQPNGPRRTVW
HGSGESFELTPVAAPLDELAPLAALFRAGRMLPLRFFPKSAWAKVSESDSAAQGVWINDR
VRGESDDPALRIALRGTPLSLDEPFGSLASIVFKPLVQHLRSAS
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgctccagctcttctactcgaaccgctacgaaacccttgtcagcgcactgctcgacgat
ctggcgcaagcgccgtccgatccctggaccgcgcggcccgtgatcgtcccgagcgcggcg
gtgcggcgccggctcgagctcgacatcgcggtgcgccagggtatctgcgcgaatgtcaat
tttggttatctcgcgcagtggctgtgggcgcaaatcggcggcgtgatcgaagtgcccagg
cattcgccgttcgcgccggaccgcctcgtctggcgctgctaccggctgctgggggagacg
gacgaagcattgccgtggaacgcctcgccgcgtctgcgtacctatctcgatgcggcggat
gcgtcgatgcgttacgaactggcgcgccgcgtggccaccgtgctcgaccactatctgacc
tatcgcccggaatggctgctgcaatggcagaagggcggttcgatcttcgcaagcggcgct
gcggacgacaccggtccgcgtctcgtcggcgcgagcgttgcggcgcgtgaggacgagcgt
tggcaagcggcactgtggcgcgccgtgcttgccgaagtggcgggcaatgcgcaaacgccc
gcgctcgccttgccgcccgcttatcgctttctcgaagaaatcggcacgctcgatctggaa
gccatctcgaacgcgcagtggcccgaagccgtcagcgtgttcgcactgccgaccatgccg
ccgctgcacgttgcgttgctgcgcgcgttgtcgcgctgggtcgatgtgcgtctgtatgtg
atgaatccgtgccgcgagttctggttcgacgttgtcagcgcgggccgcgtcgaagcgctc
gatgccgcaggccagctcgactatcaggaagtgggccatccgctgctggccgagtggggc
cgccagactcaggcgcaactgcacatgctgcatgagctgaccgagagtgccgcgtccggc
gagactggcgacttcaccgagaatccggaaccgagctggctcgccgccgtgcagaacggc
attctcgatctgcgggcggaaacggacacggacgaattgccggtcgagaacggcatcgaa
gtccatgtgtgtcacagcctgtcgcggcagcttgaagtcctgcatgaccgcctgctcggg
tggttcgacgagttcggcgatctgcagccgtccgacgtgctggttgccgtgtccgatctc
gcggcggccgggccgttgatcgatgcggtgttcggcaccgcgccccttggcgatacgcgc
cgcattccgtatcgcattaccggcttgccgccctcgcaggccaatccagtcgcgcgttta
ctgctggactggctggccttgcctgagcggagcgtgggtgcgccggatctgatcgaatgg
ctgcgggtcgatgcgatcgccgcgcgctacgggatcgatgccagtgcgctcgaagccgcg
caggaatggctcgcggccgccggtgcgcggcgcgggctcgtgcccggcgagccgacgggc
gagcacgtgccggtggcgcgtcatacgttcgccgacgcgctgacccggctgtacctcggt
tatgcgatgccggatggcggcgagccggtcgatgcgtggttgcccgttgagggcgccgat
ggatcggccgcggagctgctcggccgcctgtcacgtttcgtcgacgatatcgagaccttc
gcacagcgctgcgcggccgaacagacacctgccgaatggacgcaactgctgctcgaaaca
ctcgcgcagtgtttcgacggcggcgtggagtttgccgattcgctggcggcggtgcgtgac
gccattgacaagatgggcgacgcgatgcaagcgggcgcagaagacgtcgtactgccggcc
gccgtggtgcgcggcgcactcaccgaggcgctcgacgacccggcgcgtggcggcgtgcct
tggggtagcgtgacgttttcgtcgctgaccagcttgcgcgggttgccataccggatcgtc
tgcctgctcggcatggacgacggcgtgttgccgagcctcgcccgcgccgacgaattcgac
ctgatggccgcgttcggcaaagcaggcgaccggcagcgccgcgacgacgaacgcaatctg
ttcctcgatctgctgctggcggcgcgcgaccggctgtttatcgcctatacgggccgcagc
attcgagacaacgcgccgttgccgccggctgcgctggtcgacgaattgctcgatcacctc
gcgcaagtgtcggcgggggaaggggcgagtcccgcggaaatcgaagccgcacggcatgcg
ttcattgtcgatcacccgctgcaggcgttcgcgtcggactatttttcgtcgcagcgaggc
ctcttcacttacgacatggatcgtgcggaactggccagtttgctggccgcgccgcagcat
ccggtcgcggcgccattcttcgatcaaccgttgcccgccgaagacgcggcccccgttgca
ttcgacgaattcgtgcgcttctggcgtcatccagcgcgtgcgctgttgcgcgaccggttg
ggtatcgtgttgtcggatgcgcagggcgaattgctcgacaccgaaccgttcgaacttgac
tgggccggccgcgatgccctggcggaacggctcctgcctgtcctgttgaatagcgaaacc
gaagacgagggcctgttcgaccgcgtgcgccgagtcgccgcagccagtcccgagctgccg
ggtggcgcgaccggcgcggtatggcgctcgcgcgaactcggcgcgctgcgccaactcgcc
gacagcgtgcgccgcgaagtcgcttcaggtgtcgagcgtttgccgttcgtgctcgatatc
gtgccgcgctggcctgatcgtgccgacatcgccgatacgcttttcggccctcacgacgcg
gcgctccgcaaagcggccgaaacaccgctgcaactgcacggcaccttgaatttgctgacc
gaaacaggacaagtgattttccgctacgccaaacctactgcacgcgactatctgtcggcg
tggcttgcgcatctggtctattgcgcggcgcagccgaacggcccacgccgcacggtttgg
catggcagcggcgagagcttcgagcttacgccggtcgccgcgccactcgatgaactggcg
ccgcttgccgcattgttcagagccgggcgcatgctgccgctgcgctttttcccgaagagc
gcgtgggcgaaggtcagcgagagtgattccgcggcgcagggcgtatggatcaacgatcgg
gtgcgcggcgaatcagatgaccccgctttgcgcatcgcgctgcgcggcacgccgctttcg
ctcgacgaaccgttcggcagtcttgcctcgatcgtcttcaaaccgctcgtgcagcatctg
cggagcgcatcatga

DBGET integrated database retrieval system