KEGG   Burkholderia sp. OLGA172: AYM40_19385Help
Entry
AYM40_19385       CDS       T05111                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00670  One carbon pool by folate
buz01100  Metabolic pathways
buz01120  Microbial metabolism in diverse environments
buz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AYM40_19385
Enzymes [BR:buz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AYM40_19385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ANB74288
UniProt: A0A160FPI5
Position
1:complement(4385383..4386213)
Genome map
AA seq 276 aa AA seqDB search
MNPIELSFEFFPPKTQEGVDKLRATRAQLAPLKPKFVSVTFGAGGSTQQGTLDTVVEMAK
EGLEAAPHVSCIGSSKESLRAILNEYRAHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEFGDWFWIEVAGYPEYHPQSRSPRHDLENFAHKVKAGANSAITQYFFNADAYFRFVD
DARQIGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWIARRLESFGDDRESIRAFGLDV
VTDLCGRLIDAKVPGLHFYTLNGAAATKAICERLGA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgatcgaactttcattcgaattcttcccgccgaaaacgcaggaaggcgtcgac
aagctgcgcgccacccgcgcgcagctcgcgccactcaagcccaagttcgtgtccgtcacg
ttcggcgccggcggctcgacgcaacagggcacgctcgataccgtcgtcgaaatggcgaag
gaagggctcgaagcggcgccgcacgtgtcgtgcatcggctcgtcgaaagagagcctgcgt
gcaatcctcaacgagtaccgcgcgcatggcatccgccacatcgtcgcactgcgcggcgac
ctgccgtccggcatgggcgaagtcggcgaactgcgttatgcgtcggaactggtgagcttt
atccgcgccgagtttggcgactggttctggatcgaggtggccggctacccggagtaccac
ccgcagtcgcgctcgccgcgtcacgatctggaaaacttcgcccataaggtgaaggccggc
gccaattcggcgatcacgcagtatttcttcaacgcggacgcgtacttccgtttcgtcgac
gacgcgaggcagatcggcgtcgacgtgccgatcgtgccgggcatcatgccgatcacgaac
ttctcgcagctgatgcgcttctcggagatgtgcggcgcggaagtgccgcgctggatcgcg
cgccgtctggagagcttcggcgacgaccgcgagtcgattcgcgcgttcgggctggatgtg
gtgaccgacctgtgcgggcgtctcatcgacgcgaaggtgccaggcctgcacttctatacg
ctcaatggcgctgcggcgaccaaggcgatctgcgaacggctgggcgcttaa

DBGET integrated database retrieval system