KEGG   Burkholderia sp. OLGA172: AYM40_26340Help
Entry
AYM40_26340       CDS       T05111                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00071  Fatty acid degradation
buz00072  Synthesis and degradation of ketone bodies
buz00280  Valine, leucine and isoleucine degradation
buz00310  Lysine degradation
buz00362  Benzoate degradation
buz00380  Tryptophan metabolism
buz00620  Pyruvate metabolism
buz00630  Glyoxylate and dicarboxylate metabolism
buz00640  Propanoate metabolism
buz00650  Butanoate metabolism
buz00900  Terpenoid backbone biosynthesis
buz01100  Metabolic pathways
buz01110  Biosynthesis of secondary metabolites
buz01120  Microbial metabolism in diverse environments
buz01130  Biosynthesis of antibiotics
buz01200  Carbon metabolism
buz01212  Fatty acid metabolism
buz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYM40_26340
   00630 Glyoxylate and dicarboxylate metabolism
    AYM40_26340
   00640 Propanoate metabolism
    AYM40_26340
   00650 Butanoate metabolism
    AYM40_26340
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYM40_26340
   00072 Synthesis and degradation of ketone bodies
    AYM40_26340
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYM40_26340
   00310 Lysine degradation
    AYM40_26340
   00380 Tryptophan metabolism
    AYM40_26340
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYM40_26340
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYM40_26340
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYM40_26340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:buz04147]
    AYM40_26340
Enzymes [BR:buz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYM40_26340
Exosome [BR:buz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYM40_26340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANB75829
UniProt: A0A160FS16
Position
2:complement(1395510..1396688)
Genome map
AA seq 392 aa AA seqDB search
MRQAVIVSTARTPLAKSHRGEFNITPGPTLASFAVRAAVERSGIDPAIIDDLILGCGYPE
GITGGNIARQTVIRAELPISIPGATINRFCASGLQAIAVAAGRIVVDGAQAVIAGGVESI
SGIRARTGTNDLDPWIVEHKPDLYLPMIDTGDIVAARYGITREAQDEFSFESQRKTAVAQ
QAGRFTDEIVPVTTTMAVKNKETGEISHRSTTITADNCNRPGTTMDALAKLEPVKGLDKF
VTAGNSSQLSDGSSACVMMEAKDAERANLTPLGAFRGLAVAACEPDEMGIGPVLAVPKLL
KQHGLKVDDIDLWELNEAFASQALYCQRQLGIPSERLNVSGGAISIGHPFGMTGARMAGH
VLIEGRRRGAKYAVVTMCIAGGMGAAGLFEIY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgacaagctgtcatcgtttctaccgcgcgcacaccattggccaaatcgcatcgcggc
gaattcaacattacgcccggccccacgcttgcctcattcgccgtgcgggctgccgtcgaa
cgttccggcatcgatcccgccatcatcgacgatctgattcttggctgcggctatcccgaa
ggcattaccgggggcaacatcgcccgtcaaaccgtgattcgcgccgaactgccaatttcc
atcccgggtgcgacgatcaatcgcttttgcgcgtcagggctccaggcaatcgccgttgcc
gctggccgcatcgtcgttgacggtgcgcaagctgtcatcgcgggtggcgtcgaaagtatt
tctggaatccgggcacgaaccggcacgaatgatctcgatccctggatcgttgaacacaag
ccggacctgtatctcccgatgatcgacacgggagacatcgttgccgcgcgttacggcatc
actcgcgaggcacaggacgaattctcgtttgaaagccagcgcaagaccgcagtggcacag
caagcagggaggtttaccgacgagatcgtaccggtgactaccacgatggccgtcaagaat
aaggaaacgggcgaaatcagccatcgttccacgaccattaccgccgacaactgcaatcgt
cctggaaccaccatggacgcgcttgcaaaactcgaacctgtcaaaggtcttgataagttc
gtcacggcaggcaactcgtcacagctttcggatggctcatcagcgtgcgtgatgatggag
gcaaaggacgcagagcgcgccaacctcacaccgctaggcgcatttcgcggattggccgtg
gctgcctgcgaaccggacgaaatgggcatcggcccggtgttggccgtgccgaaactgctg
aagcagcacggtcttaaggttgatgacattgacctctgggaactcaacgaagcatttgcg
tcgcaagcgctctactgccagcggcaactcggaattccatctgaacgcctgaacgtgagc
ggaggagcaatctccattggccatcctttcggcatgacaggcgcacgcatggccgggcat
gtcctcatcgaaggtcgccgtcgtggcgccaaatacgcggtcgtcacaatgtgtatcgct
ggcggcatgggcgcagcaggcctctttgaaatctactga

DBGET integrated database retrieval system