KEGG   Burkholderia sp. OLGA172: AYM40_34650Help
Entry
AYM40_34650       CDS       T05111                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00260  Glycine, serine and threonine metabolism
buz01100  Metabolic pathways
buz01110  Biosynthesis of secondary metabolites
buz01120  Microbial metabolism in diverse environments
buz01130  Biosynthesis of antibiotics
buz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AYM40_34650
Enzymes [BR:buz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AYM40_34650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ANB77236
UniProt: A0A160FW04
Position
2:complement(3307029..3308117)
Genome map
AA seq 362 aa AA seqDB search
MDSSNRSHGARAPALGFTSDNIAGASPEVIEAIAASSAGQASPYGGDDLTARVERKLSEI
FEREVDVFLVPTGTAANSLCLSAMTPPWGNIYCHPASHINNDECGAPVWYTNGAKLVGVE
GQSAKIDPASLHSAARVKVGDVHSTQPSCASITQATEEGGVYTLAEIEALGEVCKASSIK
LHMDGSRFANALVSLGCSPAEMTWKAGVDALSFGATKNGVFAAEAIVLFDASLAPEMGYR
RKRAGHLFSKMRFLSAQIDAYLTDDLWLRNARQANDAARRLTRGLAGLSGVEVLGATEAN
IVFCRLPSAMIESLHQAGFEFYHDRWGPNVVRFVTSFSTTVEDVDNLLAHVTRAAVAHQS
GN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacagcagtaatcgatcacacggtgctagggcgccggctttgggtttcacgagcgat
aacatcgcaggcgcgtcgccagaggtaattgaagccatcgcggcgagcagcgccgggcaa
gcgagcccatacggaggagatgatcttactgcccgcgtcgaacgcaaactgagcgaaatc
ttcgagcgcgaagtcgacgtgtttctcgtgccgaccggcaccgccgccaactccttgtgc
ctgagcgcgatgacgccgccctggggcaacatctattgccatccggcgagccatatcaac
aacgacgaatgcggcgcgcccgtgtggtacacgaatggcgcgaagctggtcggcgtagaa
gggcaatcggcgaagatagaccccgcaagtcttcatagcgcggctcgcgtgaaggtgggc
gacgtacattcgacgcaaccgtcgtgcgcgagcatcacgcaggcgacggaagagggcggc
gtgtacacactggccgagatcgaagcgctgggggaggtctgcaaggcatcctccatcaag
cttcatatggatggctcacgattcgccaatgcgctggtgtcgctgggctgttcgcccgca
gagatgacatggaaggccggggtcgatgcactgtcgttcggcgcgaccaagaacggtgtg
ttcgcagcggaagcgatcgtgctgttcgatgcatcccttgcgcccgaaatgggctaccgt
cgcaagcgcgcgggccatctgttctcgaagatgcgctttctttcggcgcagatcgacgcg
tacttgaccgacgatctgtggttgcgcaacgcacgccaggccaacgacgctgcgcggcgc
ctgacccgaggacttgcggggttgagcggcgtcgaagtgctcggcgcgactgaggccaac
atcgtcttttgtcgattgccttccgcgatgatcgaatcactacatcaggcgggattcgag
ttttatcacgatcgttggggaccaaacgttgtccggttcgtgacttccttctctaccacg
gttgaggatgtcgacaacctgctggcacatgtgacgcgcgccgccgtcgctcatcaatcc
ggcaattga

DBGET integrated database retrieval system