KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_153Help
Entry
BVAF_153          CDS       T01398                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00010  Glycolysis / Gluconeogenesis
bva00020  Citrate cycle (TCA cycle)
bva00620  Pyruvate metabolism
bva01100  Metabolic pathways
bva01110  Biosynthesis of secondary metabolites
bva01120  Microbial metabolism in diverse environments
bva01130  Biosynthesis of antibiotics
bva01200  Carbon metabolism
Module
bva_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVAF_153 (aceF)
   00020 Citrate cycle (TCA cycle)
    BVAF_153 (aceF)
   00620 Pyruvate metabolism
    BVAF_153 (aceF)
Enzymes [BR:bva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BVAF_153 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CAT Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ADV33560
UniProt: E8Q5R3
Position
complement(184065..185405)
Genome map
AA seq 446 aa AA seqDB search
MVIDIHVPNIGEDALEVTEILIKIGDNININQPLAIIEGDKSSMEIPSPYSGLVTKIYIN
IGEKVHTGSLILSVDVKNEPKNLQSLHKEKDISLDSAINQQNNLNNTITKNNNNSHYDDT
KKTTSLLSTPTENPIMYATPVIRHMARKFRINLSQIKGSGRKGRILKEDLQNYLNNIKNN
IHNHYPSQSSKKENKSFDLTQKKSTINTNNTTNYISTIQLTKIQQSSGRNLQKNWIEIPH
VTQFDIIDITDLELFRKQQNLEIQNKKTDYKITILAFVIKAVSKVLKELPQFNSSLSRNG
DKLILKKNINIGIAVNTKQGLLVPVLHNTNKKNIMTLAQELSEIAKKARIENQLIPSDMQ
GGTFTISNLGNIGGMFFTPIINAPEVAILGVSKSMIYPIWTGKKFLPKLVLPISLSYDHR
VIDGVDGSKFIRHINKILSDIRLLSM
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggtgattgatattcatgtaccaaatatcggggaagatgcattagaagtaaccgaaata
ctaataaaaattggagataatattaatattaatcaacccttagctataatagaaggagat
aaatcgtctatggaaattccttctccttattctggtcttgttactaaaatttatattaat
attggggaaaaagtacatacaggatctttaattttatcagtagatgtcaaaaacgaacct
aaaaatcttcaatctttgcataaagaaaaagatatctcacttgatagtgccattaaccaa
caaaataacttaaacaatacaattacaaaaaataacaataattcccattatgatgacaca
aaaaaaactacatctcttctttcaactcctactgaaaaccccattatgtatgccacccct
gtcattagacatatggctcgaaaatttagaataaatttatcgcaaataaaaggtagtgga
cgaaaaggtcgaattttaaaagaagatcttcaaaactatctaaataatattaaaaataat
atacataaccactatccttctcaatcttcaaagaaagaaaataaatcttttgatttaaca
caaaaaaaatcaacaataaataccaataatactactaactacatatcaaccatacaatta
acaaaaatacaacaatcttcaggacgtaatttacaaaaaaattggattgaaatccctcat
gtaacacaattcgatataatcgacattactgatttagaacttttcagaaaacaacagaat
ttagaaatacaaaataaaaaaacagattataaaatcacaatattagcatttgtaataaaa
gcagtgtctaaagtattaaaagaactacctcaatttaatagctccttatcaaggaatggc
gataaattaattttaaaaaaaaatattaatattggaatagctgtcaataccaaacaagga
ttattagttcctgtattacataataccaataaaaaaaatattatgacattagctcaagaa
ttatcagaaattgctaaaaaagcacgaattgaaaatcaattaattccttctgatatgcaa
ggaggaacttttactatatctaacttaggaaacattggaggaatgttttttactccaatt
ataaatgcccctgaagtagctattttaggagtatctaaatctatgatctatcctatatgg
actggaaaaaaatttttacctaaattggtactacctatatccttatcgtatgatcaccga
gttatagatggagtagatggatcaaaatttatacgccatattaacaaaattctttcagat
atacgattattatctatgtaa

DBGET integrated database retrieval system