KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_378Help
Entry
BVAF_378          CDS       T01398                                 

Gene name
ubiX
Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00130  Ubiquinone and other terpenoid-quinone biosynthesis
bva01100  Metabolic pathways
bva01110  Biosynthesis of secondary metabolites
bva01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bva00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BVAF_378 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BVAF_378 (ubiX)
Enzymes [BR:bva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BVAF_378 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ADV33771
UniProt: E8Q677
Position
complement(422557..423165)
Genome map
AA seq 202 aa AA seqDB search
MNQKLRLVVGISGASGGIYGIKALYMLKQCNVESHLILTRNALITLRYEMNITRQDIQKL
ADFVYFSQDIGAAISSGSYQTLGMLIAPCSIKTMSEIQSGITSSLISRAADVILKEKRKL
VLIVRETPLHLGHLRTMVQLSEIGAIIMPPVPAYYTYPKTIDDIVSYNVKRAINLFGICS
KKCKTNNDEWLGIKNNFLSREK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaattgcgtttagttgtaggaatatcaggagcctccggaggtatttatgga
ataaaagcgttatatatgttaaaacagtgtaatgtagaatctcatttgatactcactaga
aatgctttaatcactttacgttatgaaatgaatattactaggcaagatattcaaaaatta
gcagactttgtgtatttttctcaagatattggtgcagctatatcaagtggttcttatcaa
actttaggaatgttaatagctccttgttctattaaaactatgtcagaaattcaatcaggg
ataacatcttctttaattagtcgagcggcagatgtaatattaaaagaaaaacgaaaattg
gttttaatagttagagagactccattacatttaggacatttacgcactatggttcagctt
tctgaaattggagcgattattatgcccccagttcctgcatattatacttatcctaaaact
attgatgatattgtttcttataatgtaaaaagagctataaatttatttggaatatgtagt
aagaagtgtaaaacaaataatgatgaatggttgggtataaaaaataattttctcagtaga
gaaaaatag

DBGET integrated database retrieval system