KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_618Help
Entry
BVAF_618          CDS       T01398                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00230  Purine metabolism
bva01100  Metabolic pathways
Module
bva_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BVAF_618 (gmk)
Enzymes [BR:bva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BVAF_618 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Sec63 AAA_33 Tn916-Xis AAA_16 IstB_IS21 AAA_23 AAA_29 AAA_25 RsgA_GTPase AAA_24
Motif
Other DBs
NCBI-ProteinID: ADV33989
UniProt: E8Q794
Position
700431..701099
Genome map
AA seq 222 aa AA seqDB search
MKKCIGSLCAVSAPSGTGKSTLICALQKKNCLLFDTQLSISYTTRKRRFGEKHGVDYYFI
SFKKFKFMIDNNMFFEYAKIFNNYYGTGKNKIESMLNAGTHIILDIDWKGVQQIKNRVTN
FFTIFILPPSKEELELRLRLRRKDTNEIISNRMKHAVNDICHFKEYDYIIINDDFNIALF
HLQSIILSEQLRLVYQKQQHNDLIIDLLSENYCKIKRTYSIE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgtataggttcattatgtgctgtatctgctcccagtggtacaggaaaatcg
acattaatatgtgctttacaaaagaaaaattgtttattatttgatactcagttatcaatt
tcttatactactcgtaagcgccgttttggagaaaaacatggggtagattactattttatt
tcatttaaaaaatttaagtttatgattgataataatatgttttttgagtatgcaaaaatt
tttaataattattatggaactggaaaaaataaaatagaatctatgttaaatgctggaacg
catatcattttagatattgattggaaaggagtacagcaaatcaaaaatagagtaactaat
ttttttactatttttattcttccaccttcaaaagaagaattagagctaagattacgtctt
aggagaaaagatacaaatgaaattattagtaatagaatgaaacatgctgtcaacgacata
tgtcatttcaaagagtatgattacatcattataaatgatgattttaacattgcattattt
catttacaatcgattattttatccgaacagctacgcttagtatatcagaaacaacaacat
aatgatttaattattgatttattgtctgaaaattattgtaaaataaagcgaacctatagt
atagaatga

DBGET integrated database retrieval system