KEGG   Brevundimonas vesicularis: CEP68_01965Help
Entry
CEP68_01965       CDS       T04934                                 

Definition
(GenBank) CoA transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc00072  Synthesis and degradation of ketone bodies
bvc00280  Valine, leucine and isoleucine degradation
bvc00650  Butanoate metabolism
bvc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CEP68_01965
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CEP68_01965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEP68_01965
Enzymes [BR:bvc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     CEP68_01965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ASE38367
UniProt: A0A1Z3U503
Position
389589..390245
Genome map
AA seq 218 aa AA seqDB search
MPRTREQLAERAAQELQDGFYVNLGIGIPTLVANYIPTGMTVTLQSENGMLGMGPFPYEG
DEDPDLINAGKQTITEIPESSYFSSADSFAMIRGGHINLSILGAMEVAQNGDIANWMIPG
KLVKGMGGAMDLVAGVKRVVVVMEHANKHGQSKVLKECSLPLTGTGVVSRIITDLATFDV
KPDGAGLELIELADGVTLDEVASKTEAAYTCAPGLQAA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcacccgcgaacaactcgccgaacgcgccgcccaggaactgcaggacggcttc
tatgtgaacctgggcatcggcatcccgaccttggtcgccaactacatccccaccggcatg
accgtgaccctgcaatccgagaacggcatgctgggcatggggcccttcccctatgagggc
gacgaggatcccgacctgatcaacgccggcaagcagacgatcaccgagatcccggagtcg
tcatacttctccagcgccgacagctttgccatgatccgcggcggccatatcaacttgtcg
atcctgggtgcgatggaagtggcccagaacggcgacatcgccaactggatgatccccggc
aagctggtgaagggcatgggcggcgccatggacctggtcgcgggcgtcaagcgcgtggtc
gtcgtcatggagcacgccaacaagcacggccagtccaaggtgctgaaggaatgtagtctg
cccctgaccggcaccggcgtcgtcagccgcatcatcaccgacctggccaccttcgacgtc
aagcccgacggcgcgggcctcgagctgatcgaactggccgacggcgtcaccctcgacgaa
gtcgcctccaagaccgaggcggcctacacctgcgcaccgggcttgcaggccgcctga

DBGET integrated database retrieval system