KEGG   Brevundimonas vesicularis: CEP68_03575Help
Entry
CEP68_03575       CDS       T04934                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc00471  D-Glutamine and D-glutamate metabolism
bvc00550  Peptidoglycan biosynthesis
bvc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CEP68_03575
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEP68_03575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvc01011]
    CEP68_03575
Enzymes [BR:bvc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     CEP68_03575
Peptidoglycan biosynthesis and degradation proteins [BR:bvc01011]
 Precursor biosynthesis
  Amino acid ligase
   CEP68_03575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C IlvN 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ASE38652
UniProt: A0A1Z3U5W1
Position
complement(681132..682517)
Genome map
AA seq 461 aa AA seqDB search
MIPVPGFEGRRVAVFGLGRSGITAARALQAGGAIPILWDDGEAGRAQAKGEGFTVEDLAA
ADWSDFAAIVLSPGAPLTHPRPHWTVDLARAAGVPVLGDIELFARALADRPKDQRPRVVA
ITGTNGKSTTTALIGWVLKSAGLTVHVGGNIGVGVLALPEPTPDAVYVIEVSSYQLDLTT
TFAPDVAILTNISPDHLDRHGGMDGYVAAKARIFANQGPDGVALVGVDDTWGQQIARDLS
DRATVISTHPSQRAEGYVAQSGAVLKDSELVADLTAARSLPGRHNAQNAAFAYATARALG
LDHDAAVAGLLSFPGLAHRMEAVGRLGSVRFINDSKATNADAARQALASYPSVLWIAGGV
PKAGGIADLADLFPRIAKAYLIGDAAPAFAATLADTPHVIARTLDAAVAAAAADAASAGG
EQIVLLSPACASFDQFKDFEARGEAFRAAVLALGAVPETAS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatccccgttcccggctttgaaggcaggcgggtcgcggtcttcggcctgggacggtcg
gggattacggccgcgcgcgcccttcaggccgggggcgcgatcccgatcctgtgggacgac
ggcgaggccggccgcgcgcaggcgaaaggcgagggcttcacggtcgaggacctggcggcc
gccgactggtccgacttcgccgccattgtcctgtcgcccggcgcgcccctgacccatccc
aggccgcactggaccgtggacctggcccgcgcggccggcgtgcccgtcctcggcgacatc
gaactgttcgcccgcgccctggccgaccggccgaaggatcagcggccgcgcgtcgtcgcc
atcaccggcacgaacggcaagtccaccaccaccgccctgatcggctgggtgctgaagtcg
gcgggcctgacggtccacgtcggcggcaatatcggcgtcggcgtcctggcgctgcccgaa
ccgacgcccgacgccgtttatgtgatcgaggtctccagctatcagctggacctgaccacc
actttcgcccccgatgtcgccatcctgaccaacatcagccccgaccacctggaccgccac
ggcggcatggacggctatgtcgcggccaaggcgcgcatcttcgccaatcagggaccggat
ggtgtggccctggtgggcgtggacgatacctgggggcagcagattgcgcgtgacctgtca
gatcgcgccaccgtcatctcgacccacccctcacagagagcagaaggctatgtcgcgcag
tcgggcgctgttctgaaggatagcgaactggtcgccgatctcaccgccgcgcgctcgctt
cccggccgccacaacgcccagaacgccgccttcgcctatgcgaccgcgcgcgcccttggt
ctcgatcacgacgccgccgtcgccggcctgctgtccttccccggcctggcccaccggatg
gaggcggtcggccgcctcggctccgtgcgcttcatcaacgattccaaggccaccaacgcc
gacgccgcgcgtcaggccctggcctcctatccgtccgtcttgtggatcgccggcggcgtg
cccaaggccggcggaatcgcggacctggccgacctcttcccccgcatcgccaaggcctat
ctgatcggcgacgcggccccggccttcgccgccacactggccgacacgccccacgtcatc
gcccgcaccctcgacgccgccgtggccgccgccgccgccgatgcggcctctgccggcggc
gagcagatcgtcctcctgtcccccgcctgcgccagcttcgatcagttcaaggacttcgag
gcgcgcggcgaggccttccgcgccgccgtcctggccctcggcgccgtcccggaaaccgcg
tcatga

DBGET integrated database retrieval system