KEGG   Brevundimonas vesicularis: CEP68_05795Help
Entry
CEP68_05795       CDS       T04934                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
bvc  Brevundimonas vesicularis
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CEP68_05795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ASE39047
UniProt: A0A1Z3U6Y0
Position
complement(1133709..1134116)
Genome map
AA seq 135 aa AA seqDB search
MHDGPAYTAETNGILIRVRPSYLAGQSDPDEGRWVWAYQIEIVNLTGSTVQLMARRWTIT
DGCGHVEEVRGPGVVGEQPVIEPGGSYAYASGCPLGTDSGSMVGAYYMTDADGRSFEAQI
PAFSLDTPDARRVLN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatggtcctgcctataccgccgagacgaacggcatcctgatccgggtgcgcccc
agctatctggcgggccagtccgatccagacgaaggccgctgggtctgggcctaccagatc
gagatcgtgaacctgacgggttcgacggtgcagctgatggcgcgtcgctggaccatcacc
gacggctgcggccatgtcgaagaggtgcgcggccccggtgtcgtcggcgaacagccggtg
atcgaaccgggcggcagctacgcctacgcctcgggctgtccgctgggcaccgacagcggt
tcgatggtgggcgcctattatatgacggatgcggacgggcgcagtttcgaggcgcagatt
ccggcgttctcgctggatacgcccgatgcgcggcgggtgctgaactga

DBGET integrated database retrieval system