KEGG   Brevundimonas vesicularis: CEP68_09915Help
Entry
CEP68_09915       CDS       T04934                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc00071  Fatty acid degradation
bvc00072  Synthesis and degradation of ketone bodies
bvc00280  Valine, leucine and isoleucine degradation
bvc00310  Lysine degradation
bvc00362  Benzoate degradation
bvc00380  Tryptophan metabolism
bvc00620  Pyruvate metabolism
bvc00630  Glyoxylate and dicarboxylate metabolism
bvc00640  Propanoate metabolism
bvc00650  Butanoate metabolism
bvc00900  Terpenoid backbone biosynthesis
bvc01100  Metabolic pathways
bvc01110  Biosynthesis of secondary metabolites
bvc01120  Microbial metabolism in diverse environments
bvc01130  Biosynthesis of antibiotics
bvc01200  Carbon metabolism
bvc01212  Fatty acid metabolism
bvc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEP68_09915
   00630 Glyoxylate and dicarboxylate metabolism
    CEP68_09915
   00640 Propanoate metabolism
    CEP68_09915
   00650 Butanoate metabolism
    CEP68_09915
  Lipid metabolism
   00071 Fatty acid degradation
    CEP68_09915
   00072 Synthesis and degradation of ketone bodies
    CEP68_09915
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEP68_09915
   00310 Lysine degradation
    CEP68_09915
   00380 Tryptophan metabolism
    CEP68_09915
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CEP68_09915
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CEP68_09915
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CEP68_09915
Enzymes [BR:bvc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CEP68_09915
Exosome [BR:bvc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CEP68_09915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASE39790
UniProt: A0A1Z3U9D6
Position
1937847..1939022
Genome map
AA seq 391 aa AA seqDB search
MTDVVIVSAARTPVGSFLGALSSLPASKLGEIAIKAALERAGVSGDEVDEVILGHVLQAA
AGQGPARQAAVGAGVRKEAAAWSLNQICGSGLRAVAIAAQQIALGDARIVVAGGQESMSQ
APHAQQLRNGHKMGDVALVDTMVKDGLWDAFNGYHMGQTAENIAEKWSISREAQDEFGLA
SQHKAEAAQNAGKFDDEITPVVIPGRKGDVTVDKDEYIRHGATLELMQKLKPAFTKDGSV
TAANASGLNDGAAALVLMSADEAKARGLEPLARIASYATAGVDPSIMGTGPIPASKKALE
MAGWSVADLDLVESNEAFAAQSLCVVKELGLDPAKVNVNGGAIAIGHPIGASGARILTTL
LFEMKRSGAKKGLATLCIGGGMGVAMCVERS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtcgtcatcgtttccgccgcgcgcaccccggtcggctccttcctgggcgcc
ctgtcgtcgcttccggcgtccaagctgggcgagatcgccatcaaggcggcgctggaacgg
gccggcgtctccggcgacgaggtcgatgaggtgatcctgggtcatgtgttgcaggcagcc
gcgggtcagggccctgcgcgtcaggccgccgtgggcgcaggcgttcgaaaggaagccgcc
gcctggagcctgaaccagatctgcggctcgggccttcgcgccgtcgccatcgccgcccag
cagatcgctctgggcgacgccaggatcgtggtcgccggcggacaggagagcatgagccag
gcgccgcacgcccagcagcttcgcaacggacacaagatgggcgacgtcgccctggtcgac
accatggtcaaggacggcctgtgggacgccttcaacggctatcacatggggcagacggcc
gagaacatcgccgaaaaatggtccatcagccgcgaggcgcaggacgaattcgggctggcc
agccagcacaaggccgaggctgcccagaacgccggcaagttcgatgacgagatcacgccg
gtcgtcatccccgggcgcaagggcgatgtgacggtcgacaaggacgaatacatccgccac
ggcgcgacgctggagctgatgcagaagctcaaaccggccttcaccaaggacggcagcgtc
accgccgccaatgcctccgggctgaacgacggggccgccgccctggtgctgatgagcgcc
gacgaggccaaggcgcgcgggctggagccgctggcccgcatcgcctcctacgccaccgcc
ggcgtcgatccgtcgatcatggggaccggcccgatcccggcgtccaagaaggcgctggag
atggcgggctggagcgtcgcggatctggatctggtcgagtccaacgaggccttcgccgcc
cagagcctgtgcgtggtcaaggaactgggtctcgacccggccaaggtcaacgtcaacggc
ggcgccatcgccatcggccaccccatcggcgcctcgggcgcgcgcatcctgacgacgctt
ctgttcgagatgaagcggtcgggcgcgaagaagggtctggcgaccctgtgcatcggcggc
ggcatgggcgtggccatgtgcgtcgagcgctcgtga

DBGET integrated database retrieval system