KEGG   Brevundimonas vesicularis: CEP68_15545Help
Entry
CEP68_15545       CDS       T04934                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc00010  Glycolysis / Gluconeogenesis
bvc00071  Fatty acid degradation
bvc00350  Tyrosine metabolism
bvc00625  Chloroalkane and chloroalkene degradation
bvc00626  Naphthalene degradation
bvc00680  Methane metabolism
bvc01100  Metabolic pathways
bvc01110  Biosynthesis of secondary metabolites
bvc01120  Microbial metabolism in diverse environments
bvc01130  Biosynthesis of antibiotics
bvc01200  Carbon metabolism
bvc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEP68_15545
  09102 Energy metabolism
   00680 Methane metabolism
    CEP68_15545
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEP68_15545
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CEP68_15545
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CEP68_15545
   00626 Naphthalene degradation
    CEP68_15545
Enzymes [BR:bvc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CEP68_15545
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     CEP68_15545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Met_10 AlaDh_PNT_C TrkA_N MinC_C
Motif
Other DBs
NCBI-ProteinID: ASE40785
UniProt: A0A1Z3UC15
Position
complement(3080268..3081377)
Genome map
AA seq 369 aa AA seqDB search
MKSRAAVAFEAGKPLEIVEIDVAPPRKGEVLIRVTHTGVCHTDAYTLAGSDPEGVFPVVL
GHEGAGIVVEVGEGVTSVVPGDHVIPLYTAECGKCDFCLSGKTNLCVAVRETQGKGLMPD
GTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANPEHVCLLGCGVTTGIGAVHN
TAKVQPGDSVAVFGLGGIGLAAIQGARQAKAGRIIAIDTNPSKFELARQFGATECINPKD
HDKPIQQVLIEMTGWGIDHTFECIGNVHVMRAALESAHRGWGQSIVIGVAGAGEEISTRP
FQLVTGRVWKGSAFGGVKGRTELPGMVEDAMRGDIDLAPFVTHTMGLEEINEAFELMHQG
KSIRSVIHY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcgcgccgctgtagccttcgaggcgggcaagccactcgaaatcgtcgagatc
gatgtcgccccaccccggaaaggcgaagtcctcatacgggtgacgcacaccggtgtgtgc
cacaccgacgcgtacacgctggcggggagtgatccggagggtgttttcccggtggttctg
ggccacgagggcgcgggcatcgttgtcgaggtcggcgaaggcgtcaccagcgtcgtgccg
ggcgatcacgtgattccgctctacactgccgagtgcggcaagtgcgacttctgcctgtcg
ggcaagaccaacctgtgcgtcgctgtccgcgaaacgcagggcaagggcttgatgcccgat
gggaccacccgcttttcgtacaatggtcagcctctctatcattacatgggctgttcaacc
ttcagtgaatatactgtcgtcgccgaagtctcgctcgccaagatcaatcccgaggcaaac
cccgaacatgtctgcctgctcggctgcggcgtcacgaccggcatcggcgcagtccacaat
accgccaaagtccagcccggagactcggttgccgtgttcggcctcggcggcatcggcctc
gcggcgattcagggtgcgcgccaggcgaaggcgggtcgcatcatcgccatcgacaccaat
ccgtccaagttcgagctggcgcgccagttcggcgcgaccgagtgcatcaaccccaaggac
catgacaagcccatccagcaagtgctgatcgagatgacgggctggggcatcgatcatacc
ttcgagtgcatcggcaacgtccacgtcatgcgcgccgcgcttgaatcagcgcaccgtggc
tggggtcagtcgatcgtgattggcgttgccggcgcgggcgaggaaatctccacccgccca
ttccagctcgtcacgggccgcgtatggaaggggtccgctttcggtggcgtcaagggacgg
actgagctccccggcatggtcgaggacgcgatgagaggcgatatcgatctggccccgttc
gtaacccacacgatgggtttggaggagatcaacgaggccttcgaactgatgcatcaaggc
aagtcgatccgctcggtcattcactactga

DBGET integrated database retrieval system